ELF(v4P4 ($#p̡̡̡ءءТТТX'H+QtdRtdТТТ0 0 ByRmK2crzEGsiD^QF HS!AdIeno @jyV*`<qVcgC'`b)-,3 =x/({NY_+TZ9\~fpi1@I6wM5Lt;auX4}"HP.Fvj  72?|)[G#>8 "6 $904. &, L(^SB dCsAu|o OftM8'r;D?vW/w1lRmKQ[Te=*pUZ-}:a%$]N%!h_k&#nxE07z:~]Pq3<+h\JJUbXgk>YlW5{O |eآ((:A<^d  +b  7@ h a VXH@ ^F"K;L n , UP8 2 TS0 7*  I )om  00 xi\Q ]1b 5 \?  @b K c \ i   y ^<Fp Z = !IL t~ )( A Z Dq\ ( +  | 2 $  p/  b lT zbn Re U Q< 5X lA @$*< = Og@   k} # Rh ql '` qp l @ 3 `<  i A/ , n$ ~M R` 00Z c\D p B 7`* :4  # IrB< r^   x\  __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesmemcpy__isoc99_sscanffopen64fclosecurl_maprintffwritecurl_mfprintfunlinkmemsetstrtoulares_getsockares_process_fdares_library_initares_library_cleanupares_init_optionsares_destroyares_cancelares_timeoutares_gethostbynameares_set_servers_ports_csvares_set_local_devares_set_local_ip4inet_ptonares_set_local_ip6strlencurl_msnprintfcurl_freesigactioncurl_easy_initgetsockopt__errno_locationinet_ntopgetpeernamegetsocknamesetsockoptstrncmpbindstrchrstrtolzlibVersionstrcmpinflateInit2_inflateEndinflateInit_inflatestpcpymemmove__rawmemchrstrtok_rstrrchrqsortcurl_strnequalstdincurl_slist_free_allcurl_easy_strerrorstdoutfnmatchfgetsgethostnameDES_set_odd_parityDES_set_key_uncheckedDES_ecb_encryptwaitpidkillstrpbrkaccessgeteuidgetpwuid_rsocketpairforkdup2execlexitmemcmpcurl_mvaprintfcurl_easy_setoptcurl_multi_add_handlestderrcurl_slist_appendcurl_multi_remove_handlereallocstrdupcalloccurl_global_initcurl_global_init_memcurl_global_cleanupcurl_easy_performcurl_multi_setoptcurl_multi_pollcurl_multi_performcurl_multi_info_readcurl_multi_cleanupcurl_easy_cleanupcurl_easy_getinfocurl_easy_duphandlecurl_easy_resetcurl_easy_pausecurl_easy_recvcurl_easy_sendcurl_easy_upkeepcurl_easy_option_by_namecurl_easy_option_by_idcurl_easy_option_nextcurl_easy_escapecurl_escapecurl_easy_unescapecurl_unescape__fxstat64lseek64curl_mime_namecurl_formaddcurl_formfreecurl_mime_initcurl_mime_subpartscurl_mime_addpartcurl_mime_headerscurl_mime_typecurl_mime_data_cbcurl_mime_filenamecurl_mime_datacurl_mime_filedatafseekfreadcurl_formgetstrncpystrcpylistenacceptstrstrcurl_getenv__ctype_tolower_loccurl_url_dupcurl_url_setcurl_url_getcurl_url_cleanupcurl_pushheader_bynumcurl_pushheader_bynamestrftimegetifaddrsfreeifaddrsMD4_InitMD4_UpdateMD4_FinalMD5_InitMD5_UpdateMD5_Finalfeofcurl_mime_free__xstat64__xpg_basenamecurl_mime_encodercurl_strequalcurl_mvsnprintfcurl_msprintfcurl_mprintffputccurl_mvsprintfcurl_mvprintfcurl_mvfprintfcurl_multi_initcurl_multi_fdsetcurl_multi_wakeupcurl_multi_timeoutcurl_multi_waitcurl_multi_socketcurl_multi_socket_actioncurl_multi_socket_allcurl_multi_assignfcntlcurl_getdategmtime_rfflushrenamesendtoEVP_MD_CTX_createEVP_sha256EVP_DigestInit_exEVP_DigestUpdateEVP_DigestFinal_exEVP_MD_CTX_destroycurl_share_initcurl_share_setoptcurl_share_cleanupgetpidcurl_multi_strerrorcurl_share_strerrorcurl_url_strerror__xpg_strerror_rstrtollfilenorecvfromclock_gettimegettimeofdaycurl_urlif_nametoindexstrcspnstrspncurl_versionares_versioncurl_version_infosetvbuffputsSSL_get_ex_new_indexSSL_set_ex_dataEVP_DigestInitENGINE_get_firstENGINE_get_nextENGINE_get_idSSL_SESSION_freeENGINE_finishENGINE_freeERR_remove_thread_stateSSL_get_ex_dataSSL_alert_desc_string_longUI_get_string_typeUI_get0_user_dataUI_get_input_flagsUI_OpenSSLUI_method_get_writerUI_method_get_readerUI_set_resultBN_printBIO_ctrlSSL_pendingSSLeayEVP_cleanupENGINE_cleanupERR_free_stringsCONF_modules_freeSSL_COMP_free_compression_methodsENGINE_set_defaultSSL_readSSL_shutdownSSL_set_connect_stateSSL_freeSSL_CTX_freeRAND_egdRAND_statusRAND_addRAND_file_nameRAND_load_fileRAND_bytesOPENSSL_load_builtin_modulesENGINE_load_builtin_enginesCONF_modules_load_fileSSL_load_error_stringsSSL_library_initOPENSSL_add_all_algorithms_noconfBIO_s_memBIO_newX509_NAME_print_exBIO_freeERR_error_string_nERR_clear_errorSSL_writeSSL_get_errorERR_get_errorSSL_get_shutdownSSL_connectSSL_get_sessionSSL_get_versionSSL_get_current_cipherSSL_CIPHER_get_nameSSL_get0_alpn_selectedSSL_get_verify_resultX509_verify_cert_error_stringENGINE_by_idENGINE_initSSLv23_client_methodSSL_CTX_newSSL_CTX_ctrlSSL_CTX_set_cipher_listERR_peek_errorSSL_CTX_set_msg_callbackSSL_CTX_set_default_passwd_cb_userdataSSL_CTX_set_default_passwd_cbBIO_new_mem_bufd2i_PKCS12_bioPKCS12_PBE_addPKCS12_parsePKCS12_freeSSL_CTX_get_cert_storeX509_LOOKUP_fileX509_STORE_add_lookupX509_load_crl_fileSSL_CTX_set_next_proto_select_cbSSL_CTX_set_alpn_protossk_pop_freeX509_STORE_set_flagsSSL_CTX_set_verifySSL_CTX_sess_set_new_cbSSL_newSSL_ctrlSSL_set_sessionPEM_read_bio_X509_AUXSSL_CTX_use_certificateX509_freeENGINE_ctrld2i_X509_bioPEM_X509_INFO_read_biosk_numsk_valueX509_STORE_add_certX509_STORE_add_crld2i_PrivateKey_bioSSL_CTX_use_PrivateKeyEVP_PKEY_freeSSL_get_certificateX509_get_pubkeySSL_get_privatekeyEVP_PKEY_copy_parametersSSL_CTX_check_private_keyX509_INFO_freeSSL_CTX_set_srp_usernameSSL_CTX_set_srp_passwordENGINE_ctrl_cmdSSL_CTX_use_PrivateKey_filePEM_read_bio_PrivateKeySSL_CTX_use_certificate_fileBIO_f_sslSSL_set_bioSSL_set_fdSSL_CTX_load_verify_locationsUI_create_methodUI_method_get_openerUI_method_set_openerUI_method_get_closerUI_method_set_closerUI_method_set_readerUI_method_set_writerENGINE_load_private_keyUI_destroy_methodSSL_CTX_use_certificate_chain_filePEM_read_bio_X509ERR_peek_last_errorEVP_PKEY_get1_RSARSA_flagsRSA_freeBIO_s_filesk_popSSL_CTX_add_client_CAX509_get_ext_d2iASN1_STRING_dataASN1_STRING_lengthGENERAL_NAMES_freeX509_get_subject_nameX509_NAME_get_index_by_NIDX509_NAME_get_entryX509_NAME_ENTRY_get_dataASN1_STRING_typeASN1_STRING_to_UTF8CRYPTO_freeCRYPTO_mallocSSL_get_peer_certificateASN1_TIME_printX509_get_issuer_namei2d_X509_PUBKEYSSL_get_peer_cert_chainASN1_INTEGER_getBIO_printfX509_get_serialNumberi2a_ASN1_OBJECTX509_EXTENSION_get_objecti2t_ASN1_OBJECTX509V3_EXT_printX509_EXTENSION_get_dataASN1_STRING_printX509_check_issuedd2i_OCSP_RESPONSEOCSP_response_statusOCSP_response_status_strOCSP_RESPONSE_freePEM_write_bio_X509BN_num_bitsBIO_putsOCSP_response_get1_basicOCSP_basic_verifyOCSP_BASICRESP_freeEVP_sha1OCSP_cert_to_idOCSP_resp_find_statusOCSP_CERTID_freeOCSP_check_validityOCSP_cert_status_strOCSP_crl_reason_strftellcurl_global_sslsetlibssl.so.1.0.0libcrypto.so.1.0.0libz.so.1libcares.so.2raiselibc.so.6libcurl.so.4GLIBC_2.7GLIBC_2.17GLIBC_2.4/home/wh/opensource/vz_opensource_package/output/targets/arm-himix200-linux/libcares/lib ii 7Aii LТԢܢ $(,48<@DLTX\dp|ģУܣDHLPTX\`dhlptx|̤ФԤؤܤ $(,048<@DLltĥ  $,0\`dhpЦԦئܦ $(,48<@DPptxħԧاܧ  $(,@Htx|ĨȨ̨ШԨبܨ ,048<PTX\dhlptĩЩԩة  $(,8X\`dlptx|ĪȪ̪ت $(048<@Llptx|īȫ̫Ыԫثܫ  $(,048<@DHLPTX\dhĬȬ̬ЬܬLPTX\`dhlptx|ĭȭ̭Эԭحܭ48<@DHLPTX\`dhlptx|ĮȮ̮ЮԮخܮĵȵе $(,0HXhxȶض(8HXhxȷط(8HXhxȸظ(8HXhxȹع(8HXhxȺغ(8HXhxȻػ(8HXhxȼؼ(8HXhxȽؽ(8HXhxȾؾ(8HXhxȿؿ(8HXhx(8HXhx(8HXhx(8HXhx(8HXhx(8HXhx(8HXhx(8HXhx(8HXhx(8HXhx gg  2$2D989_@_m<m̵Ե4صܵ%3ILu    $ ( , 0 48<@DHLPTX\`dh l!p#t$x&|'()*+,-./01234578:İ;Ȱ<̰>а?԰@ذAܰBCDEFGHIJKLM NOPQR S$T(U,V0W4X8Y<Z@[D\H]L^P`TaXb\c`ddehflgphtixj|klnopqrsuwxyz{|}~ıȱ̱бԱرܱ  $(,048<@DHLPTX\`dhlptx|IJȲ̲вԲزܲ  $(,048<@DHLPTX\`dhlptx|    ijȳ̳гԳسܳ !"#&') *+,-. 1$3(4,5064889<:@;D=H?L@PBTCXD\E`FdGhHlJpKtMxN|OPQRSTUWXYZ[\]^_`aĴbȴc̴dдeԴfشgܴiklnopqrstwx yz{} $(,048<@DHLPTX\`dhlptx|@--hJƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌƏtʌxƏtʌpƏtʌhƏtʌ`ƏtʌXƏtʌPƏtʌHƏtʌ@Ətʌ8Ətʌ0Ətʌ(Ətʌ ƏtʌƏtʌƏtʌƏtʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌƏsʌA-pA@,`PA`Ad0 @DTP/@-@TP@0.S00p@-? P*:@PpP$ ; 0 003/*: |" l0p003/ :+S00 0; 00;p;0;ppL9p@-BM`P0 @P@$P! 0p0?o20S1P ,P80 -0003/BߍpT8O-@H8 0S p嚰P :S`( H2D rp y(p H2Dppp `40((O Pc 04 S70700 0V0 Zf`  x0`S  l`0SpF0P<`0s `0, 00060$060(00S 00 "06l"R  P  $R Q,0 Rl2V0S R@ (m0!r@ $e0 0V 00P Q P#"# " QHHL L " DH P$"  " "!"! "  Q Q-P "Vl"  Q| QxPs RpR `p pQgQ/ R / PZ#PVQ PQ VPNHBL00 LPDGP?D QQ60  Q HPHH"DH Q#$" !"!" |||P QddrP  QH"L k gg SP X!R aZ 0x R R 0 x0S G 0S 6 Xt0` 0o/o "\PQ Po/o "\QP P "  " R(H"L ggRP wwRP x!RX!RX PP x"R x"RW Q~ @T{ PwzPr|"Rn0 X x"R  0 mW |"R 0`&S`VaL\ P<Ѝ ,$( 0 0 R/.404000CS 00/ 0S//HHT.88AA(00/ 0S//HHDH.L0L 00 S/@-400S (0  00 G-3G880 0R 0S @-3/@@ `-G-PP` p@04/@P 0`03/P 03/P   &/$#/40P03/ 03/03/@-(p@-0S%0S" S S ;C S\@ \S ;0L0`DTRPPU@+P 0 Pp+Pp\@-@P <P  P toTo8oO-IM M(, 0`$4pLP@@⥏0 P P Iލ ЍጿP($@[P  0I P 00,00 0P$0Iލ ЍnP P P (/ ///Hmmm@-<0< 0003/@P 00)(G-P A 1@p03/1003/P# !`P& 0003/@P!   PP 0S0S S S #S \03/y03/0@3/lL)$nQ+/A-px0W0@h T` P0@3/ 03/03/T03/03/00'O-R`QMP R@ 0[  Ѝ@T ЍPp P 0P40 P] 0u _pWd 108010<0!1@0 HL@D\@20SA SC S  0Q9 Q; HQ @ p,vl \`$ dh(  W ` pSP 404003/{8 @< DHL@4P  `'kkjjxjxjXjXjTi4jO-M@T P?0L /L0@( T@X@Epv`Pp0Y) 0 0pT P@ [ R0P0  ទ% 2/ 2/ 2/0P%0 D %00 4 %L0 8 x%0  l%@ $ `% < =SL0  L  "RPLP:P P PL@0-0CS`L`P@F0D$S4 80L`(00 :SP 0L0 "Rv pP||d, `@P R Rb ;R L 0 S63   \P0L `00SS L 0SN S S =SI0L0 RC0L0 R> R R "R< UL;0 S;S  ,S00S   ;S S  ,S00SA L0  P0 Sp "P# L0 R R0L0JߍL0"SS 0 0L0 R"R L 0S P$0K?oP20S,0P PU0] 0 (   @ @P 0 ,00$0lU^ UY UT 100( 00L 0,S< Sd! 2#;S  R0  =@"D(02(0P PLPAP@*P0L S "R 0D 0P0L0+L`0 <`@D0D0 L0kPhL00X00P00H00,$xhhXhh|hhQ$@edaaaO-p M` ЀQp R U @P [  1/ 1/ 2/U Ѝ.P 0R 40 00@L0/êQ/p@-,IMT Q BP`  0S`R 0 Ѝp4TP Q 0 S 0S 0S ` @ 0ϬЍpA-`\0\ 0pP03/@T P 0003/0000PO-@MP  H`pAP0 A 㴠5@T0  PĠP  崀T ~P 0A A! YXP Ѝ N ЍE@-nP-80LM04, 00%P PLЍ-80LM04, 00P PLЍ@-@0 P  @Y0@- M@0 KϠ0P 0  0< /2a@#b! ?Ѝ0Mb0A-,IM0P 0`IT 0S 0S0S@Ѝ  0 R0 0 k0S Y0()0R@   Ѝ^@O-,M`@00 P0n 0 P> `P `Pᜡq!0 R 0 01೗B`"`!1C"c1 10 0 0S/ /C#b?yP3<)2P *00 0()  0,ЍI0 _P0Z0 Z0Z000`0Z00() ,Ѝ  0,ЍMbO-`(Q(1P`0 M@0p3/P% 0$ 03/<)0 $48i(i<)003/PP$ 0,Y0[P 00 00@0 00 Ѝ \00 0 P@0 0@ 0$ 3/$Y(0Q 0S/@-0 PP+Q@- 0 I@-0QM@ 0S0 Ѝ P+0c#!c!0@-0Q4M @P 0S . 0 4Ѝ0 P+ 4Ѝ0O-04M@R(X 0`0P 0@t@4Ѝ1 1003/0P0 Tj !p  !1 0 , $/ 0T,09 0T-0 60SP@-,!2.00< .2,#Q ,3 Q%BN,0  Tp $@P0@P003/X04Ѝ0@D.0P? B N,0  [N,0  SpH XX0O-0M0P`pBP@=Ѝ0S=S  W 0 =SS=SN P1 0  B0 3/0P0 XW 0B \p PPG=\( A\ 0\ 0S\3SWX" X5% 'x% pY  P0000S=S0=S   ' %4 ' 00003/=%4TSDpS0000/@-@P 0S 3/0000A-@Pp` PU 5/p`//A-`Q@P` 0003/pP U00P 0S 3/<0pP00p : 0|3/p@-,P@PPpŋ00p@0/< 0S Q R 0S/p@-P@ ⠋ 00C0|#p@-M@U 00SUPЍЍ0@-P@M   w0  lЍ0@- 2M 0S@ !0|dR4   Ѝ@30P0@- M@PL P(  8800 ,nT(0(H Ѝ0H P/Ux p@-R@  `x (8RP jp(8Ppp@-xM\@P`  GU    TЍpC- P(h0M p0@P0 0 ͊ 0 0|C @0x0S $Ѝ 003/P d@@ ॊ U 0 (SP @@C-|CMT(x RP`0S 0W|3 00C0V x0S Ѝx0S  W  T 0T TP0|3  TG-@QM( x0`Sp   T TP @T@ @8/PP TYx0S Ѝx0S ЍO- M U@T# `p@T Pl2SJ? ]@X0pTW \((00C0 ЍpO-@,M(8p 0#x0S  4 AT CTP8 0`00 @T@T Pl2S 2J? @Z0PT TP0S  00C0 x0S ,Ѝ p @-0`S@ 0 MAp J?T@T ЍoT*8@P   T ЍI(0S/C-IM M H(@PP`p $ ( (e 0S PP ( 6 #100  TPP( 6H(#100 hV(  R Iލ Ѝ( 5Iލ Ѝ@0P/@- M B  `p00CP@S,0 0Ѝ!2Qp` d`pp0 PP h aЍ0 Q|`}Ѝ|G@-M 00@ 0 P0jSST0Ѝ0O-a MV@R ܁(1XZȟ [;7'`Xp0  ЍR`p Q yN `Vp [Z `py> `VpZ 7'XP0`py> `VpA-`@P. pV 0S 0$P 9@,l0 cߍ 0P$@,0 cߍCCA-PbM@`p 8 P @,l0 nbߍ0 jP@,0 Ybߍ\C0C0@-@P0 @0.0P0 @0 10S!RY 1S 1 <3/PU U00100S<0 0z Z?P45,SU000 00H0 0D $0l0P<吰`("?R ڎ? q = k0S X0S #2P L2L0L<081ߍ66 # (0Pf[! (0PxP!  (0 P| ovP!,d0 < ߍ< *B!<pP U sU ,!0 ?X< %00Rꀠ  0SX PT X 5P0000 00  PD !<$ (T ,00`zP :P 0S ;0 ;-X< ;1>"#<VPD!,O< 90 S 0 0%440  H0  8300[+ PX0%XS%44%440  {PK0  L0}  L 6PH $ #20#2<P,!X0 < -k P_0000$ S$010001D 0  SP D0$ Sa !.( ,QD0 0$(HDRD0 00R M00 (050 S0 (  PY%44 00 0Y &%4400!0 KP,!X00 -- %(wP00(0 0P %44Q0  V0000 { 0Sd ` -00><<H=;0<$::H:<:D98`8l7\676G-0AR8aP81 pv   L R 0 PpL0S  R @0Q  R 0SL 0L0O-@@b_MV <@  _ߍP0@p0 0@0CS@?0H0 0<4L0$0040,0 rM 0<0P0&P(0h Pr #2o<[7 0S1 . P,x<İ 0 $5 00S /` \ 0S  \0 0WP T@Z P0XT 81s_ @_ߍ,n0V<0$2 <[0`00ꋿ 0 PV<pP a08!L0!L @0H C/o8A!2"( 02a!28!R 8A`  @P70S 0 7'f0H @"<1s 0P 2$ `7'PK,<x0 8nS@(0N01sgd< ' U`!2|`d` !!?P0l$"0 $" c@66h32C-P M@ pP0dO 0(P0QL0DP @Ѝp>@P LPP@Ѝp00 00/(0 000/P/P//A-p`p0`0Pp03/@P 03/P00@03/L(0S /@-@! 0A  S P ^ 0SS S0C0C S PP 0S0C S0C0A0 Q@- C=>=--0S 0 0p@-400 @PoP80 l / vP00p/D  kP 0 0p(p@---A-P0\@p`0 \7UP 004 003/00P 00 -S1! B0CR  0 S 000S p@-@T T0 00 40DP8 P00p/(p@Y+S  /F0O-00CS2M00`s 1 p0   0P 3/Pj 100  0@ S P-P P1003/ 0S 0S00 Ѝs0S ( 07  9c  9/P  0$i80 xP 0 0   00 0ЍO 0+G-8\M@pPb \`A \ \ 0' U   SЍBPK 00C  Q;0SD (  0  Ѝ SH1P003/P)  00 0Ѝ0S0S P- 0 pPEpPP 0   00S PL0003/0 PPEpPBpPP- ^0  //P/S /- /G-A@Pp`PPP@TU$ 0003/P @@ `p, P@T P`@T@F ,0,00G/x&&0%p@-`@@PP@ 4 $0003/=pp8%S /- /p@-@L0T0pP< ` 0 03/03/@Tp82O-0pM0 2 Ÿ0 (00@ @0 0 `P,P PX @Pg@ P`P,P00V0S VPB `Pp p\ xPDDQDP lP 00S& Q  `P 00S PU RP P ! 0(P P PЍ R  P U0(P1 01hЍxt#X#p@-@x0x 0P 03/03/0 3/03/03/03/0(3/0$3/0p@/X0 000 R/O-P MA1 P YX Z Ѝ`$4;0P@ R4T0C4[ 0 @[0X ЍA R $4@p@-P` P+  @R P (pP$P#  @R PP  @R P0 00Rp R@P p R@ R@P A-@p`V0@@PP VT.@oA-P0Pp03/@P 0`"S& V 0F "R 0/S/R000/S l0003/\0A/  /RS `F  `F@-/0S$M,0S0!S0 ` ` \ -p\pppP0\" @Pp@@$ЍS .R p p` `d00` `` `T T0T` 0`D 8d@TttxLPdp@-@P \JP p. `p P  @.j PP PU0EP`F`V ,@HBV@$pPpO-MM80=80p=004 `, (0^_?@P0803/@P V >P;0S0S S S 000>匾0$0>A0<0x> 0D0l>0H0`>P0L00 Pf` > VP0 S0P0 0R S SS  B S SP 0r@S00V 00S S S 0F 0s Q QS `C`0pS0S S S P _R  RY VG $Ph x- ` 2/`-003/P  03/ P Y 0S 0pS0S S S ;'Py Pt(P 0 "S0LP% P'0 n `q@VX`p 04SyV 0 A4@040 A> P0ݍЍH,0A 0|P0 p/00#S P0 0P00 P p:00: 000:0<0:0@0:0$0W񏐒&Sf0.S:0 03/L` PVoob`  , Pg qP kP@:p 0 3/0 oo 3/Pb`0 -0Pl 0&P  R 0 0`p `00W0S{ @9 p03/P  `P 40 040$|P 0 3/ p qooPWbpV ` fPpa,`;Pa$ XPM (0S 04S0-00=S( ` 2/ 2/0PS0000( <3PQ ..RpP =<00Sa =<0H`P=<0`P X' 2/@'003/Pe 0,0|=<0PN  42,000m _RK >P[4  4 @(0S 04SpH `W`6p$03/P V40 -`V  0S /R0S,0S 0dV 4S 8 4Q0.` 400 9 0paV(OQ P , ,0R 0SB `P P0SP Q -0S -00/( P  B P`.pWv 0 40 P03/03/03/0 3/03/0 3/0$3/0(3/03/00S 04S@ 0 4  @ |#x ^0d -00&P  Rqpp0&W00S= 1@ݍЍ P0/0u0=SrWP` .pW.0S @1 -0S" p0 4 DP8 HP? P"( 2/8"003/P(=,000 P 0 P0R~0 0@u! 2/!003/P0`(1!$ 2/h!003/P$ ,0X$ P4  4 1 p03/P  v` wVPoob  ,`0p(80(tdXLp4( (X \ d  1 000S'0-?o< 2R0S T0-0< 03/P 0-?o 2R0S& =? P =0/ B=P 0- 0@`03/P =  0 P 0S  0 0p690SIp 0#P/ @PZ,`0 4   ! sE"`  2/ "003/P V%N 540040 <P&Pq"=<0 p LP "  2/"003/P p0&j=/lp$3003/d 0 02,`p0T 0 0)p0&LO-@MT TP$ 1`S  >EAT 0`0t4`00-00#09 Q ,00#0 4P- `V8 Pp3 403/P ?P00 /R#0 0 W ]P W  0/R 2/@T `RЍ 0 2/@30803/pP P 3003/P P 2003/P P 2003/P P 2003/P P l2003/P P D2003/P (P 2003/P({ $P 1003/P$q 0,0-.00  000/ 000,0@-T./ pD 0 2/@T<|XPF,0Sq=0 003/03/PQ@T$d1q003/@P& V0D ``V`00 2VG0`0 Sp h0003/Ѝ`V @VT`Ѝ`MX(P/A-`P@P @9T`UdP @-@-T/P/G-`{PU 0 0@UPP@40C4TP`W` P /A-P0p03/PGoP @TU0A/့O-p2M0PR@0`o T$[ -R9 RV <00Y tC  2003/@PF Pp |P#  P 0  S0S S S " pP09 R \1 0 H1003/0S 0X4;0;Ѝ t 0003/U) 0S`Ѝ 0003/`P 0 T00 3/P 1$4v D0 003/C,(p@-,[Up @d``6&20?P PU, ,[p@ - G-6̠S , TU `AT 0S pP PP `@T X 6hP ,0003/[PPꬳO-(E崃,MT` ,;S  vWe (5@ 00-Sp@TmD3D0 0FQ 3003/PP 0@0@G0S  R10@SW2 0NT "2 pEP  03/Wm PPpP03/0S @03/(E0 t0S x0S \0P M06,,ЍP i@P@ 0P0< lP9 \ 0 Q4(1 f mP03/00S , P ,K ^@P03/0S 0P@@d0@H0003/PP@L00~$0@|꼲(D,0P0/p@- P@03/TpO-x1M`P0 0U 0YQ P8#<4D! 8#8p0 Z  0ᰠ00pY1  Z !0 @4/@P   U P0X@Z0  U 00 `@03/TPЍ蜮(G-(a(` P@,p4/@P5 0003/P0 U$ U P0`03/03/0  >0 XEX$P $0 ( cX0P0  %0P 00P03/p@-MP@` P0 ЍpP  P0  ЍpG-`0`0p03/@P P 0R0 ` lR Z0 PP0 # " 00@03/P<(P00//P00//P00//P00D//| 0@?o2P0S00_//@P00_//P00//P00//P00//P00 //x /0 48 / /RQ/0@- DP#G-@p`P@ P P 0P ST @ A-0@PP`pPPD.PpR  B0 * R 0C@ 0CR/ S//@-Pp` @'1 M0`"##Ì!0  0` l Ѝ@-`PpM  0  0  0Ѝ@-MP@/ P``p  pf t`@ `  0c 0[000000ЍA-@`PPP+" 0刀003/pP0D 0CC S@ rX @@@@@003/,0,003/pPp,O- S QqM@@p@ЍP0 0 0 3/P [ ` @ XFU 0 P`B 0A AQ<D 0 8<$0@0 03/z|O-\M@D0Pܱ܁ P00C2`3c @〓@D;a`ad1"Th `0`p7/pPPC ))@@@ @@@40 +Ƞ+D  @ )$ @ +L08, (@   @ , ( H@0@ <PP  D0p0`\Ѝ,0003/\Ѝ({C-P`,M@ i eX X0 p0P p;@P  T P,ЍO-@`p` 00P Pp EP  Q Y :Y PU00PP0`03/0P 3/ P iŮ꜠O-ppTMq MP ݍ Ѝ@0ST 0S P5 0S2 @`Pd 3003/P[ 0F @  P< @,HU0 x3 @03/03/ ݍ ЍLP 0S0`Ph 0S@# 00,;R/P 0S ,`V 0S@$0`P N@H,0 ໯}pT PA$0(p0u (0p0` ZP "  0 2" @0  (@,H0 } 00,;R/PN 0SJ(n$0,!0@ 03/03/#$^(\@H,0 NO 0 00 0 0  v@,H0 3V@,H|p0 %H넟8$X0@P4O-M@P`0I@娡 T y0 pC @TPP0 pB P:  @P4 pW0G  0 RD @RW# W!R* D0S 0KS+ AS0FS0 S0003/@ @T@@50S  @Ѝ+0S0YS0RS0KS꠆G-HR㩟 P @WaP`=@PP tP0S 0003/P) 0 00S S S00x0 d* 0 08 `O-dRM`p? -]N0 P@⩯⟟ S R8 R8 RD @ 0P:1 0 H 0 00P-1@03/[ 0 3/0 00SK 0^ L1P@ ➟00(1003/0  ЍX0P * 0 H` 0 0 ` 2/ 0S03/[ 7 00 00S0Ѝ400z,LpTTo4ho@-@ @C-+M0@ P= @ 0 PP< P qP0 -R4 P0 P% PU00/ UP p0 R R0 SR  0jz 0@P@PЍ!Ѝ pv`pȊ̚0 *:@-2`@M`ЍP@u0P s0P mpl 0 007@PP00 K@4 EЍ @= l@-0 M@0`3/pPPp02 Ѝ20=SS0  Ѝ bPP00 @Q/ .G-pP@`P `Q @T PY@T @PP-T_T 80`0a0`01謄D(p@-@RMЍp0PS0`00` ]P 00  0P  T 00L0D- Q 000100 00 00000@00@0=0000!20/O- P`pP& #0  {@3003/T0 0@ ЍB@b` Ѝ@ Ѝ Pl PT PM :pP@ `:Pk @:P0ST` a`0SA@`P !0 ` @`1003/T p`q`ap`t0S HaHA`@qQN  @aX 0 0C)ჯ  2P u 0@P0 @P % 2/ Ѝ  @>R  @& @8   0PR 0 2l$l  0PR L  0PR 0  0PR"<  0PR@   0PR   0PR   0PRx   0PR !R tR d  0PR&@)&  c  0PR&Q   0PR&@   0PR&"!   0PR Y ) ~ 0PRtH$%R \ p0 0Pp&R 4 e0 0P|%R  Z0 0P%R  O0 0PH$K%R  A0 0P%R  60 0P $R ` +0 0P$$R 8 0 0PH&R  0 0PH$"!  v <4P{h  2/  0 0Pm  0s 0Pcp}p '+N''''t'5'Q'uq''\']'N}':(0G-P`dqdp `0M0D3/P) @#2(@0#2D@P6 p(60  0P "n@31@0003/AЍ<40<4m3P p(&"n 0 P "n<40<4w(H O-hM\ O (Qx `;00;00;$P0,0;0 0S XP@0SFGE0D  BXPsW@Xk$P`L s@TPB0D$@T XT008#<*4 8#8! p 0n U 1P02Y`!0 S 0P P2/@P l W  p0X@UP0 0x0S  W P@4D$1x0@S [T `0(I(0@3S$P@3@TP H9@003/01ߍ\0@  0 @w`pvp`E D0W 0u  0 fWI@ PB/YsW$P@[3@TP`ߍ `  0" P@ \00H@ 0@2S( 70 D `V R G@ 2S@$). 0!2`` R lG@d70\G@`hsWʤ0 (G0@ 0, LI@w 04 ! \0,P@0P@\  U:$H\  @ @DPH 0,P0 00 S+ @@,P 04D0 D08PH086,0L0\0@004P

P ,048P

202@,048P0 PeNg~@p0PTP0 PFT ]PP X #1h3@S3~0;Prp0(H48$8$(40 0Q$84 620&P , P P, $ P D10 03/P$ ;0;( P 10 03/P( w ;0;Q  Pm6S /Pe 0&R 5220)PW8[0R<f0M@l0HD0C.$$00], p=>=<;:9876543210/.-,+*)('&%"!   //O-DBPR$M@}p`(Uy PE2@F00 0- C 0QR^PO[MLKJIHGFEDPONMLKJ<;:9876543210/.-,+*)('&%$#/.-,*  cP0Ev|$Ѝ 4TP $ЍPP@$0$003/$ЍQ6n) RO-xMR@0DphpL! 2/0P0* W; `C000P% 0 PZ ZP p[P@( [%0@?o20S P  p 0003/ЍP 0  0 G P0@ R 0@0P Ѝ8O@-@`MR@`P00 000pPU@ P\@Ѝ@0003/ЍM0 ?0 000/L@-000 00@ 03/PL(@-AH T <0003/00p0 t00L  C-;M 0 0 0P,`@P` p IP 00@03/Ѝp6 0#20  0 ,+2 %%@K,0O-@SMH0ᛑ( 31 4fp; 0: SP ~:0S˄ LV 00c0!'P P 0᜛PP Sߍ/P8HhPa 0S%PSߍ`pLPPȊ̚X0KX0V 0 `V p0 R( ,00_(0 R0*Z (0 `RȊ̚ 0  04 QP$Pp @\ $d08P4P<0V$ (X0 0P(    $(X(,  P. 0 Ა0P *P+P*Pu 0 PPl0dPPf|0SC4x tPv.1 lphdP P$PP P 0ۚPP>0 ǐ6K 5Hğ*:0< %pP> SR *:R0048d(0 `  P.dPU *: pR& RP0*:  U 0{ᢐP p*P (PJ,P pP4PE8 Z0U] RLP!c`pS|l`l࢙$P  B0P /` $ 8P)<P P 9 Z8 > Ȋ̚3Sk Pf0P0 gPyP)Pp*P(`,pcV$c`p`0QLP! p7PnBPTPR ㊿P> *:*P L!cP`p0\ P*0KH!AAd0 00X0/B(8 p@-@P p(0<P03/ 0< p@/hBRQG-|PppP l000@`3/P@  ᔾp +(0@0 03/G!B-O-锺@MhP: #H T1@ 8#<4F0< .P: 0cP  R8 ,$cù 0(I0@ 0@0۹pPb@ 2.pU[000O,㝹@0 F0 <4p@0峹P øO,刹 2<m@P O,x " 0/ C0 "20 S 0"20"2,\ V0V""44 8 #8R\ R Q QRL R  R@04!HCr  0<4T#QH x@R ,.R  R`  H! #4 `嫸01,!0@0 s~@P@  ᰐ<  0@TcQ,  0 0  R~`P z ᐐ@<  0H#, `T#((ԍȌԌ` 0hP<A-A0MT p@ 000_P 00S7'T0Ѝ`G-退 @M`4q儀&P  ᱸP  d2Ѝ w` Sv !24a@0!2z$20$21S x1 3/` xV 4!r ,0410*22ЍЍ4 0@- @ M"2P X3!S 6> w0 " T3 Ѝ0\௏ PX3!S> z 0  0Wp@-0@PP@ 0S 900p@0/t0O- PM18000 0pj\PI4SI Sc@/ȷ`P $303/V@F@P(  2/0(#P  40@,3T 0S~ 6$#  42#S "@@$l` $P FTX `D2003/ Ѝ0S @00S/S` /R023 "@D @Z S h u`@@0S  /S0SP5 x103/P(F  p,3S03/pP9 ˶,#(,q@/S`P8 V ` PɎ0`230003/6$ | Pz0Sw|׎`0003/@0003/ Ѝ Pr pT(T<G-0 00P`03/P @p pḳ0P  =AP DP ;0; 0p#t3;0;;0;\哳0P h(̃01@-Q@  0AcS1SQ @5S @+  bC<5S   |P 0T#T3S1S  |P 0T#h?C@L  {P; @0;T00K\Hb0AQTÓ\0!- &@ 8p< T|  04410| PR S0/@-@P0P P 0 S ! 0"> 0p@-0 S @Ptࡍ""h0 ""\ 0 r{Pp H30H3 0T#p଍p `4O-PeOM5`, @0<00Hp3/H3< SW  OߍS 4  OߍW8804 0S 40 04D@@P p$`<@P` p0S `P 0  P0@SP p$` 8Q< R~@P{D\x00Su40Sr6 d0 P 3 "0 0d3/<<3S 0 4046!2X 2,00 00?P 0, R+ 02PZ6@~p,0p03/&2-pp0<03/Ppi !2@0!2 0Tsb (4P ;00000:080 90lP1 hɌ GPPŒ@ "82<0SYH ,&0Pc , 岶R 0<#ौ#,KH3SW 8 90S>: R;;0S800S8*Y /6T1 "0 d03/P<a,0 , SR6;. $3 yPp 0T#p,3Sp@ipp@7> p@O(3 0d 4 xPpTp8 $3 xPp 0T#pyWtxs! Q&@-@@& $3S &    xP 0T# T#2l  xP @@L,5S 4  x;00 00pw,wvvvC-0ARcSMPQ@` p  ঊT T TB T@ Ѝ@ຊЍ@ @4 pS, ,QL;f$2$" 0P0 3/U@ !0 Dx@03/T  0T# @1Q 0 # @@P0/ 0夲P 0 YI @,Q+ !! ! 0 03/,5S;00  0+ X   S 0 d`  0 vTvu`H,ThH@t4 g 0PT#4:"20"2P( QP! J P40H 0000,00(00$0  @լP 6 $3S 6 P8qPyP0L S0 v.8<@  & HD  %0C1  0᳅P T5%0 rPPR0 R 0೑W ; 0h l0L 0ᾄh0 0ค PP& ф਄0 T3PH @P@TPDPX:P@ 807W8P00 UT H$0  ᅬ 0GPPh8P00 1{ cP]5S{"2@x0$P3RR 0L#H33H#001# *rPP  0T#=P95S "2@ P.838#0 rP  0PT#!W I0 Ÿ0 !Ƞ 0PP  .1 WYP|PxPR@l< 0@l0 lP᮵< 8AP@To DЍ  0   2/@#  1#P0~t~F`~1cSS+++P`OOtONMMNMA-@k< 0P$Q,0Q0(( 0QvS0W 4$,0& g 7/P0S g. H0 > 4P @੣P mg0 0pdxM0 0040/(p@-@4`TP` v0003/00p` /O-;儿@,M 0S 40U?o20SU1 W00000-W000 W00t W WS00 0 000000000000000OP W 0pG W *0 W00E W D<00 C aP  tW D0n0 00h W  $ Wa<  B 0 APS < 0 0( CF 0 0 00;0 0<0D0 C3D 00BD0.< 00C < 0 lP00S 0 `RqWV8 0@0800 00 P.W:W ;00 APL<0< 00C0<   00S1@s08 8 0 00 0 0l0 0m  < 00C00dLPLtLXL@L@-N0 0P  0S @000/XA-@`pP$(lPgTwXg\w`gdwhglwpgtw8g=<;:9876543210/.-,+*)('&%$  $0R0 06C0C;S zsfa^VL@1+> p0o WPp 00t, d1t10  60V0<03/0t >00r00(0,5SE 00X0>0000>0000$;S40v4 0sx|w47  q0d47@  HL0W0Q0Kr0EhlX\u8< 04v0/x|0*w0%hl0 X\0u08<047  q0 47@   0HL000r0h,0 \,0 $0 ; 0CSrahonmlkjih[fedcba`_^YT,0 ,0 *0 +0 +0 +0 +0 (0 +0 $0 *0 *0 ;S l,0  ㉰0+0 (0 ~+0 z+0 v 0 r 0 n 0 j 0 f00cP6 ;0CSL00D00<00400,00,P(.Aln00ȇ/O-0@+| $M R0q 0 TผPU`h qPg0000 0`20003/VR0 0P' 0ivPQ 0 wPJ 0PE0U0 ီP0`pG0`q uPE<  0S0 Q0 P3/  06v`P#0 }w`P0`0 0]$Ѝ 0  000 3/`0 03/Pv$Ѝ`00003/Po7`p400 $.p@- @P Q`P ㋴00p 0p@-@PS@P 2/0 0 0 0p@0/᜸-  O-TY`p@14  03/BT@T P0 5/P  600C003/@P  0 p  m60 0003/P  R <@@ N6  RLG-PU! p0 `3/BRT@T 0 9/P  D600C0G-@T 0 p 3/BT @T P` 0 6/P p@-P``P` 0S@60@S$0003/00000p茵G-`PX0Sp B T W0P  7/P  500C0U@0 S P@- *0(Q Q /0@- <o0 0/ Q 0S 0S0 / R R 2 S /O-@h1h0  P M`p5/PP8  0 @0R 3:03/03/W 060#0 ;/0\0#0 ;/Z0W*`㔀0 3/0 3/0pS Ѝ03/ 03/ 0`3/pl'0@-03/A-@P`Q` 0`03/ 03/,p03/0p003/脱p@-@P`[ n@P S0 03/ppQp@-@8PR` x0S  49$){x0PS "U <9(Y0<9pPYͦG-a0P` 0QSPP 0S@1@03/pP 03/PW @0.SPᏛ@0*.S00ᖛPP5 P@.፛@P, .∛U00PP! P.vP$ P 0I DS EP  DI@@᫘@@D0P03/03/@0@P8H$0S 0BS//@-@ʿ0 00@0/ 00CS0/@-  ㉜p ˜A-P`@Pp1p#W 0FT ` 0A 㒛`"0A-M@P p h`P 4s c 4R0  ASt`s hs`ލ; < Ḛp hP `!p0P 0S//0-0\ \0 0 4s/@-h0MS@ x0S  Ƀ< 4h 0 x0S ʃЍx0p@-S@P`  㫃 jPP000x0S 㯃pO-  0 Q1D X 5/P} PD0T0D00Ѝ0S L` g0P00, 0P00 0Pp000d o ZYf 1`0 01<@0$010(010,010401080YP:0v Sl! 0tx| 8 4Y1 PAt0 SR ,R(  $ 0  qy+0@T.0P0妔00嶒0| 0  2/0 P<@0啔fP00ꌔ    P l , 0 00040p00P@! T 0 PđPЍ(pp ppT,LTA-p@`!2P 6 B  城P 0:0CS@T$BO-M\@PD`i \q \v \{ \( @\0.VB S ' V |#Q q |Zi 0p 0 0 0ЍtD#Q <#< V 2X 00 0p 00 0Ѝ!2 GPt 0 0@R 00&R  06P 02X 003/࿎PX 5 h20X2pP0 @R42pP0  2pP0  @01pP0 ! ! AP 0 0@R 00op-|+ QC R> wP 30 0 0pP 10 3/f굞``tx+0S0' 03/V  N03/0S 0 3/ 0 0@R 0 00)   pph00PD^L(]L[[[A-0q:SS@p 0S:SS@PP sP Ï`P V PT` cP`PEl0`F003/PP`  00 ᡏ`Pႎ`PP꜀&0RA-dC\R@c\PD C `@!R  ? "S KS  " 6 pP; 0;9Sf 2YW> ;SS "2T 1003/ 1!0$ 03/PC P \ g6  " p!S KS00""0 @P; 0;0KS9"2 ;SS 0$ 003/P 9090QP 1 S8gᥥ0:pA- l@ MP`$ !E  P YU  P YU pP$ 90 9; "23XP 67  00 090S" 90S "20"2Ѝ \0 .  0P P) 9 0) 9XX "20"2ЍdڋP909O-0QM0 0@0 ^Pn$#0  #s Sp ,  P, ,PP%0( 000 RR00z 0,SS 0S,S,S@PP P0SЍP  ᯍP ,PP0: f̳P  ᚍP ,PP000 0R00 0f; 0;ꮳP  |P ,PPE0@00 @0@R00EP 0 00000bP P { P; 0;0 Sx 0    ҷPe n \`P8[P[dO-MH0 L0@P qo`pH2L0J0SG ? @ R Q YH 0  eP%@ 0 HR1! 0C 0 eZ 0h  ?W Z 0 0 0\0X01* 0 0 Ѝ1S ? @ R Q  Y H P 6̔ R1L ᕋLhH0  ` N!1|00i:J 尰 ЍX7 Ѝ Qe,M-P @ Mp㕣7`P 20S P6L2D000 Ѝ2S P [ 0#R rP ``!2p  h  T ̕T>0h/-  P p0 A-@`p| PP" @PP &P vPP cPEU`* V@ PPE  \PP=Pp@-;0;:` S 0 S @@Q@@TQ SpdPӛP P P ;00;p(P;0;pp|X: S 1 S 00 P00SP//;G-Ġp@ 6娠@ #T:`xd@T PP 0 S P  P  G lXO- 4MQ p 60 b 0(`003ࣟ0$03 0030030030 0V[ @:ᦋPPp @PPLP EP0SUA @d;S   P ;S S "2p;S P1S P|  P ; XP 6  !U@ h2003/TU`V0 0R0K  (0a 2 00C?o2Sy& b(` 0 $2 ,0s;00P0 @PP ΰP R [;R 0P{d! 2/PPF : @K0D0@D@ @Pfm0$b 0(`<@4Ѝ $sPm U 0003/` dP` \P ;Rx SPhpdP kU@55c@\p(3S/0 }P<$Q-p0003/WໆP 6 "0P P 0SA0@0St 3;ha i PppW ЍSpp8hhh O-aRPp  R#>0 004ຘPC "  @1031 ' :("@P  @P000: 0 @ S0 S   l0 + @bT 1+@P3+ H2D0 0GS162Wpp10113@0@00 0S@@> SR"2: S 1 S * SR R S1Օ01ŕ0 R0(?a@0O-(0C$M@`q S_87"2> SR 0BE PP!PP0 W/-P PP1 0  0  0ዠ$Ѝ"20 SR*: 13ΗP| 0Ķ, XX PP "2> SR 0 13LਗP 8ࢗP $P & f;0 X1S !R +X 0 0J9WPP0/-0 $PP0 S00  0tnPPn/-P PP 0 0 0PX1 30 YPPI0 0# 1 3{0 @EPPs 4(.PP./-P PP `PU # ;0 PP0 Vt3 0*/-: PPP <_0 SR;0;813–P_ EPP# _þPP 0 SRC;0;`_P ᪾PP134 0 IPU0 =V PP13*> 0 0 0 (V"200E gPPd r XkP@0 rPPz a"2 XPP W0   + KPPK ဆ X?PP@ ;PP; HcXhPX8 0 , H4D(O-$5MS@P` P 6S ;3 P@PPX Ѝ00H2h{D0WdpU P po0+P xoUp qЁБС@pP 0ܽPP@T+ Q U  ώP  @ @0S  R U. P ! 0ᵽOoB ЍO蚽@-PǃP _oR;30S} zP~l P 6$%S Rq0ST|4HX,2@-+Tq Mp QQP@* TT ` Ѝ*P1\ 003/? R0+*:  0  R0ः\ P``Pt0\ 003/l\ X> \ <>  R0\ Wx@RR0G-Ȋ̚ M0& X (+` @p2PS7 F*:t`p1/PFU> R  R0R*: Ѝ/@PJZЍ]U ]Ȋ̚`p 슔: H8/UP#P3PP`pUȊ̚V 0TX?U07P  0y]Ƚ|1G-S@`p 2   000 1019]Ȋ̚ 0  3S :S ;SPYX |@]!ȕPP>L; ]-$]$A-P @`P@ 63 p0p @03/Wpk ypP 0` S T  P~0p 3/p;S$ XR$,,O-@ `7X ć|M0R@`0 1S 3S01 Pq@P |Ѝ@P\0d ]Yh 4 :Pu d \0 @6 03/T0` 3/(;`KS Pi @PT 0T 3/0T;f@P`0\ @P\lP4@T \ @P\@P: S  !: R/ RSC h H[ d o@P8 Bd \0 9P4 |ǁ0P80. -@q85S 0T 3/DTK8ുPT $(ୁP` 5040S) @P 23080d;SD0 L;SH0 X;SL0 ; \;S<0 5S 0S P;S 4 R p+RP 8%R R} TKT (+R `+R@ " R # 8`Q8 0@ <0 0P L0( 04 H0$@ 0 D0 Ժ@0X 3/0L X3/L083/ TWH2L01S :S @PG3S @P>\0@SS 0 0 GZ?@ 2& P 6tZ@@0 03/kЍ< P `P*P P P @P: 0*:6S ;3t1" рP 3S6 F6 @a 2= H%H P1( ஀P ` 5V  ࣀP` 4Vw KoFcV6S  P H2L0  jP' Y"6S l yPH2 L  aV``dvP 0 @+H2D0@Ѝ UPe!` KP 85S  ᡚ@ @gЍ 0 @ 0Ep`w +F@ ЍpP@" P1 SS S 0 0 0Fo @2@'x@XXX@ H@P1  1@01 P; 1S8s0P @TO &1@i 1003/P @V@0 iTX@r0 [@PCjz0 WV<101`㿖X0\}P2}P, }or&$0003/@I8L(TX0DxTL|$`p@-@ ?o+2\03SP 0˄ ;SR101 \% \ 0SeR d0BcS1R021 R 3Sl<0l<101p|3X7 1`0A-pP@WV! N> @@R0@@TP 0N0  0 0 0 0/ X?O-а @p` \M0h:^0 0\:< 0$0P:P000D:40D08:0(00:0,0080 :0@0  P @  F  @ٶ`P)0S  0HP 0 S Sd0LcSpd\ e\`V1 101qo`Pm \Ѝ̠0Z0"H2D0 00L00P T0 *PZ 101S ( PR `P `P6`` 0Wᓶ0 X`P኶/= 0+;倶0 0 0JР0S( `b0 S1R01 0 2  `7\ X7\ 6``SL 0W`Pw/? 0  0  0 0 P@dAcQ 0 0`PS0KS "p60S ;0CS"2~1#6 0 00 0000 V\ЍH2D0 6S 0 0?0 0u00K00J00L T0$TKN~PQ K嶣P0YS0cSTJ0 S ,V` 1 01]1 0R1T 00061M00S 1 E " f! R Ix2SEpIV; 0;=TAV000x|2S2L0S 0P ,}PB K[P KV61X3 R 6  V0SJ 0 00DL0 S 01RS P00`u0 R0J0h 0J0L0T`1` 0FST`a0S |30 U| `PP0S` 0HP101ݓ6,U`14ϓ6 1010S0<0Ȁ00а U`UᲓ8\PM1+0100H"D * +R' HwUᗓ1^;R kU+ 1 +@ $ 003/8.DZU1SxRU 101  P ex 0aU`X> |D<ȶ//0 $0 0'O-0 `06M@p@_ 1 l3岿000 0SwLE>0 S S0 0 S 0 00Ѝ0 S,0 0@TpP0 S S| %P  Py  &@0 UPr 0 00 S0 S Ѝ0 Sm S T06@ !  0`Q] ʕPE0  R0 @TP  00 p 00 S0 000 0幡P$0 S; 0% 0 %}P20 0bS/ @T0%P$0X  ᆳPt 0 #UPF 80Ѝ0 0B@TPpT0 $0 0KX U~|T 00t`@P L/D/</4/,/$// L\x p@-PQN @h zP=pP PPP Pp@˴ O-,MQ @Z -]n~|倻L P`!0 02/ Z V [X RZ 5 ? 3{P0 @d ^yY0 $ 0 p>@0 03/T0S' @y00 3/0S  00 0,Ѝ 003/Y@,Ѝ~^ ltx pX P`\T[  DR @ 00 0,Ѝ.0|0@-@ @0O- R 0 L0[0P0v P`4P4 00s4 p00M004 q0P<0 8 00R4  p.sPP0@  CL80p0P`40000T<0pP0`40000J80pP0`40000<0?K`P4PP0P+p3@0$ ~q0$yqP`4PP0Pp004 .q0P80 4 00 4C?LD0tX0\ s;\S+30D0Iq0Pp40  AqP <08 H8q`P r L0[pPpPDPLttP0@ (!qPPP P (q0P0 rpHr$2 H0 pP8pr0 pP ;0@@  ᥄ 0 C 0*XP T0HH 0 ; 0N #*X P X h DCHH1l*XP% X X $ DC P0 P+P0S S 0  0*X0Y 5S  d!X  S D@X @ X p D Pu z0<%3 |D0(/56M3 IP 0 #^X 5 S @DZ J3V0{SS 0S{S{S  tD 0 #CH8l50<0d50800S1 0C0S@%23 PP @00 BQ00 R00ST T% T- T jP@EP |P P0T0?% 8jP0 M3 <iP0 N3 $iP0 O3AP TQ hP2 3003/ 0PS> IN3S@3% CCHP@ ,|kP <3T003/ 3T#003/T CN!20 3 0  jD00 0 S |M#R %#R4 ZP 0 #o zP0 L#lPL0@CT }R R0SP0 ( `CP0 !:"R, BP0T1!X 0 A 0 DP0 @PP0  R0 0 0 0 6C"R) Bh2@CBP0 QP @  0Á@ ւ 0 C@0@ ˂ 0 C |0003/022 )tp( \~$,~}|D|{z||`{H{yty0O-` 4M⬛0 q 0@!0C ]S][ZBA?>"! Q : 00 B0]P0;S9弹0 09 009$009000=SSP 0S=SS 0 0 E6PP0@!0C ]S_\]\YXWVUTSRQPONMLKJIHGFEDCDC@A@=<;:9876543210/.-,+*)('&%$#$#"! P00,00 E(0åP- $fP 0SL $fP 0SQ $fP 0SV $zfP 0S[ $rfP Q,0( S 0C/P( 0 (06$ 2/0(3/0;S8 0S 0S_ R@ 4Ѝ0T/S D  4Ѝ, (R  B/P0(0(0, (R  B/P0(0 (0, (R  B/P0(0(0, (R  B/P0(0(0,Q 0Q 0/P @0 0S@P @P07 07 07 076A  P  P PQ~ eP P TQ e6 <2Sb 0S PqPn p4 @PP03/T0Ps3/TsP S@P=  03/XO 0 #@PF0SC 10S?  0y700 ;RR .3$@03/0(3/'2003/0$0$0Sp20$03/A0SG@ <2S; 0SPihX A0S <2S*P0@P  :1003/X 0 #x@ <2SA@2#^0@2 :h0  PLNwP&  P 10Z:&0S @0 g>@ 0S#0S 0SK PP 0S ~w0S0Ss rrttttomm@ml llp@-M`P/@P0S 10SЍp@ 0Ѝp0@-S 0S\0 00C ^@ 00@/0S000 000/ \ Q   R0 0 /000 00Q/ 0S/p@-@PP 0QSp p /@-pdM@P`f0 enfdЍ@-pdM@P`h VhddЍA-l`l0`pP03/@P 0 3/P0 P03/  @03/0@-03/p@-@003/(0( 0P03/03/pd@/Q/@-d ` BR1Q h  @ h  ` T ` LQO-`d ^=A p` P\@-QjAQpP\`(`dAN^,hi`j NN?? ? N \d`Y\*H^QP6RQ4PR) =   d `R BR i h$(B?@B@`d@Q` B#?   `  ` \  \ P g`f@P0/Pp@- 0AQ _TL 0p@ D00p/0-Q Q R @P0T0P T0/0/@P0 0PP0 0@-$0$ 0 @03/00p0 0@-PPH MU@\0`0d0*Q $ 001/p PP 0P T0HPL0h1 Ѝ00h1 Ѝ0P/0S/0- @P@@DP0$0    ( \ ` d H h /O-`dM ^ Pp0D"Db ` h X"BDD@P  @7 PG PC = @ R+ \  LR & @! Te jc  R\ Q \ `d \  ^pG0` Ѝ R3"Q+ @P@3@"T@ThXP, @ R i  X R  @ R Ѝ@T @\P h  X Rj  X RjXPZ,c(c= @-@QM Ѝ`d BR*R`Ѝ@h  0b0 `A-@P0p`P0 TʘWP P@ bPpp@-@(4PPP d0(00003/00p|p@-@P-dTF `aP? 0;S;<9876543232/./,+*)('&%$#"!  pp@-RM@ P7 6PPPPPPPP q P `P pQ 0S0 R Q rPPዛЍgPP@8(zhp@-@0ST@@@ p@0S@ P`U PP@UT@ 0@@D@H L0pG-p @ۗP` *@D T @! a  0 $Yc`FP@$0@@R/p@-@(0MS`P Ѝp@b, ydP0( Ѝp ]p@-P@`Pp0:S@0 Sp0 S ppp@-@PcT ` ?o@2T0Spp0@-@ M 0RSP( P dP Ѝ0P Ѝ0$ 'dP( [O-R,M0 P@`$L`  T$H0  H$  @$ SygTG P,ЍX0S ph0d` $0`Q0!03SQ `V`d`VhPP*P $0,fPprPw*PpX 0`  6/P pj*000 0d`0C 00\`dLH0PT`0 0 0 PP: [P L`H0Vj $P 0`H0L`PTVP pGb  0 PP0 `P T0L`H0i000,`H0PTL`]0 L`H0PT Tp*d` p`d`gXPAPA*P 0 L \H0PT* UP,ЍpbgW:`d`M00`H0PTL`$0L`H0PThPP*P 0  (P  b ( pl: UP$0 `pX  3$28HO-@p WV$M@P P0 R0`ha$Ѝ 0S S$U$p `X"D L"@0  @"  8"  S]Ya?((P gaP`V 00S`00 $06/`VWv v P0  0haP T0$ЍZL 0  nPGPG*P 0D@HL 00>a 0Z  0 HP0 PU` D@00 H L0@D00 0 0 HP0 DHL @0Vc*V`0p:V`.|VxV 0p@-`S@` $3/0 0 0 00(0\0`0d0 0H0@D$@ h,a0 0aPT04`03/04P<3/0 0PS` $3/0 U $@ 00 00(0\0`0d0 0H0@Dh- v 0003/P0 V@`D pp p0 0  0+_` ^0$0C-q@PplM+`P 0PS $3/0 U $@ 00 00(0\0`0d0 0H0@Dh`2 aP5 X103/P' 0`@ D0$!$1 0 0  03/P8 P_5/P0 p03/U- Y`P`03/lЍ 0`@ D0_`Pl003/P 0@D: S00 @ D0,000`lЍ贿8>>>P/h1S0h1 0S/$0S/@-@T@T 0\ 5105 8 202 8#/0 0000/p@-@`PUQ0@҅P@̀PUp0$S@@p@-@M0c 㹒P00Ѝ -- M 0 H\ ЍЍ/O-M MPj/` @`P 0 ` P%R 0RX ㈀/0 bl \ ?4J0@0 Q000?0/0P0$0$? 00?( 0=:7,+*)('&%$#"! g     pHEN`FVEB3Q񏐯LQGCINTYDY^r_}|c  @p0` 0| Vz`0 p0p0 *R< Vy`0p0p0`0|p0p0_0P0 X0y `0p00%0 0 00000@r 01;p01{ m .0 1; 0-00FA00F0+0 000 0 0000S#0 0000W02`5`%Wp 0X 0 S000`(0% 0W S RQ01NC0@QgP0 4ᔶP  42 4@PሶPpG 0@S0G? 0 0( X00 l0 000m  e0E0 00 `@FX`PP 9/p ލ Ѝ.0 @1 ;㰠. 01(( ~C  0SPJ @PZ 9/p.0 1kV  9 00000(00pP,0 r0000 h040iO 0Ǵ00D 0`p00 O?40C0 R PB 0B SF SB  T 3RPE 00CDT 3 #\ R,0S(0PES AoPEUPE `u  9/pPE.0 1KT 0sP\ U`a0S 0`C pV`F) v$ 9/p`FP  R F`PW  0 3 `V(00 C`x2003/pP: 00 0DP 0 #40 0`0 9P 0` 3P `1P03/03/V 0` 002$0S**`V`L1@03/03/ )$ 00C0 0w  $0*`P0S, /02 )N>  R 0  0 0　儐 0LQZ` T)?` `gd |@8LO-X4,M0  Qtk(4V00y Qx{W~ Q[ P PYP y  ⪣@ 0 @T0  ⪣ 0(0 A@ P Puh ) ,Ѝ0H# 2/0P0Q  MQ  RO0M <0T 0Q00 0  0  0_# P P + l)P t2@03/0t 3/0t[x 3/x[x{WL P(bP`PP= r p @0  N ) [ 0-Y4Z@ P d1@03/0t 3/0t[x 3/Zx[l 0آ",ЍqpF q p`P@[: (Y: (  ` +0 0N 0@ @  )$  Nhl8^^$]]@-B0@o//0 000/\0@o/@-'0@-M@P?AP в;PʲЍ0-1 M 01 E Ѝh9S/  Q  R 0S/ -p\> (00C S9 ")(/.3  Je䷸0S3 00CS981s0<1  s1 x#01R0 [H2 0S   /H2$0SH2(0S01H02S,0 0080/ cF4O-0dML  L0P0D T0X0\0`0@, 0$ p400,0040040 0x40(00`f0 I 0At0@  0  PP ,0d\ H T LT  \   $  $ (  (  BP (0S$```4Z 80,  :/p `pW,d0S1 0K` 1 0P`0 0400,008000WA L0TP00 T- St4@(  共P6 ,0 \ 0C(0A($  B$ S"4Z 80 :/pY 8@共  9,d0`S HM $\LdpdЍ $,  <@@@ x1,003/PPC (0 0 0奰0 < 婰P) ,0S  \0 S, $``F$`(00C(0`$`0(0S V``0SO[0 0dЍ``$  t0003/(0$`$`V``. @ <@@@PPT~(4(@0R /#2 /@-dA-@M `(]l0 0GJ0W P0X 0]P000Ѝ00Ѝ 0@-P@M ?N  L0 AL LЍ0O-hYM%U㖎p0 0 PV @` @\P0h9S @ L@ 0 8JЍ0D9H9Ѝ0@-\0 MS@ \\\0 Q Q 0 P 5/p Ѝ0000S0S 0P00 5/p0 0 Ѝ0G-q1p0M`03/@P7 P\1`D0ᾳL1L!00D10 xt  Z`P.$Ppd0P0pd 0KPpp pPkPЍNN000Ѝ Z $,00@03/v( aP/p@- P@U & $0 0pp@-@0  Pd&H2<0S 3/p@P 41\ /0S /O-`MV< p@쀟P0P#P! !RR!0S`V@0@Ѝ!RR  P   T@  @ @-@P M Q  Ѝp  0ipP0e0 NP LP P  Ѝ H(D0R0 /@-, @003/PHPr0A-@P0 l0 RpW`P=P 0 @3l @@ @-pP*C-@PM# p`V q `P ⽮P 4pW 80  7/p@ P$̮ 〮w00Ѝ@P$ tЍ-0@-PM 1 R PЍ0@ Ѝ/PUP!0Q0S QN QV RQ! P   @!Q& 0!Q= 2 1Q  P  R Q Q P0Q:0Q0Q P @ 4  P 8 @Pd0uKP @P 0S@0P0@0E!Ѝ$ d0003/`P 005$ <0003/{0(0@} PKmP 0@-X@MT Ѝ0\S  / P 0@-T@MT Ѝ0\S  / 0S 0S(/O-p M[0@[ `pP X/0ἦ/0崦0b!t!R =)B -B Ž `a& ▎ `GIpP  hIT9 p `0pS @  XP0 0 QD9%mS@H9S ` XP0 Ѝ `\ \^F P 8!0\ dYE\ Ѝp?BTP 2 R /Q 1 R /p0S /0S /0S 0S /0p@-P@M(1`S  0p@ `M iI0S 0SD (0S0(0h0S l0S D0l h0x0S   ((x (( R  4 P  PS0P 0  2((6( 006xP 2Ѝp#P 0p@-S@ pP`5H@Pmg(0 S 0(0000p@-$`MV @P(0S 0(0P^$ 0 ;@0;ЍpG-;cPBM` pBߍ@p R203/0Q3/0GSQiH2 0S  3/p*W k?oP20S *ppx0S  1YlRUL;0;DQ ጮDPPᗭ0L3/8LXSn ` 8PS` 6(2 x2S/ |2S, ^ bVx0S Z1 d?oP20Sp0H3/0H8dBߍ 3x0Sw ;1s 2 Y H"L    @0 P gHx0S 1WP048 @0@ 48G !2 h c G-M0 P@WP0pЍ(0S8 SA 0 SR 7'V됐 0 2 (0S Ѝ7'V됐0   ^007'V0D  7'V0 G-$P 1 R PU @pTP(XpP@V ;` 0S l0ShᬭhPlP(XpP@Vx@V` T$DHH0003/h^ &p0S/D)RH)R/%p@-\ ^@ \C PPt9S`  lt9S0D9H9p ^@-@@O-@㬏\MRG@H@I@L@ ?\ P\Ѝ0pST/0  H/  @/ 0 SJͰ@(0  C RQ2  C R  Q R4S'qU]'6 7P 0 2@q -] 0S L 0 @J0T(0SSn PU JͰ L0J  P(0 S PL0S @T PS(0SEu @(0TS @T J0Sc(0S' 0p (00 0C0Z(0S 0G0S| ( Rw 0 (0P( L0S @T 0BSu^RRLP6S%  3/(0S0(0u @TESL P*0 L0\(0 S0(0L0P,0* @T? #28 L bL0S;L3(0=S5 0S PL AP *0L00 H"L  "0 l\ q\ L > @(0TM  CR40S (0U_00TKk!> ( ,00K0I  WI0@8P0SLT H2L000#\T@@T 4\ 9\ L  @(0TS{ PL0$ @#"X"r 0(0 P @PH20SL0 P P 3/PLP0SK S (0 S @TS'D @T H20S Xa 3/PL~H0 @S(0TSS P*G B @L 2P0S2S P (0S0(0L0PE0  ZE0LS_ PX [ L 0 @J0T(0NSL RS P* 0T "L @  |PT <9( 0<9  LoT0S  PP T0S G PL  (0 PSJ SScH8S 8@ L1!R?!R6G F cYPL; ;@wPgF0Sy (0 @S  0T(0 P0V jZPLT(0S 0 (0[Z8@   @(0T  CRgSSW 0S H20S Xa 3/PL %[ L 0 @J0T(0SL0S AT t0S  T < 4/t0Sΰo P6 @ 0H20SL0 H 3/PLHQ;;3J(0 S 0 @(0T @G2Sp !23  t0Pe0S 2 0 S H2 R G 2/0PU!2G 0!2(0RLS @~ 0T(0 0S L0 J FF*0L0Z L s(0S7 0p (00 0C0. D00@<  (0S0(0kLP PE_oR  R  _(0 vZ SL R6 y L0D!"#L0P @(0TSn!"|@d@;3 ;S 0p (00 0C0 @(0TScL0Sb K0!"L@H0/ 0 (0 @(0T  CR h0LG00 (0k @(0TS?L(0S0 Z, (0J  CR(0T 3LtG0S (0S @PT L(0S% 0 (0Y @(0T`r'7 $z40 !N(0,@0 $O(P0 0  00w  (0 S 0(0 0 R 0 N ?PL_00!> ( ,00(0 S 0(0 @(0T6 Q @XRu (0 Sr 0T(0 mT\p< @$P0`40GW'74{(P00@P i*0 L0 @0S=2S:(0S 0T(0R T yZ0PT RL@L0,0+(0R S @ T(n  7Y(0 @S0(0TLV\"r+#S 0P(0@P (0 @STP0G0!20!2(0L S 0 @J0A`r'7 $z40 !> ( ,00 $( 0 00@ ``U0@ 0  s @(0Ts# @$P0`40@'7P4{(P00 @(0TV @(0TQH20S L0G  L @!2@(0 Sz 0 P(0w 0 2 @(0T2I0SK0S 0\ p R0p0Sz{ P L0I X(4`  N T {XPL P(0SP 0 (0WP0T3/ @( L@TL0@T;P sP( { R  P( (0 SA @(0 "  R 0BS( n2SkG (0zT? ? (0 S0((0$0Y @LT (0SgSP V\"(0r S x!"@ S 0P(0 0 @(0TP SH6003/PHv @LT(00 pLG0Sd (0SX @TRG  P( P @T W1Sj 7T`P03/1AT0;X@! XP0L J0WL TQK 7PPL P2 7`03/ @( ;0S i @T\ (0SdmP0J0jH"L   +V0 (0 @(0T@6 P(0 S0(0 sWP2(0S 0 (0{VLTPS0(00 PJ01S 8T`03/1 A T0OW0LT3/LQ 0  J0LL0SLT P(0Ss 0p (00 0C0 @(0TR&\0P0 P0!O-@M OT 41 R pЍpWp` PV    R `Z pV 6 #100Y :?p\`0\ =0\S 0 ]0S0W0ʰpW 0Spp O-pMP`@3OWft @! `ʢP @NPPp    0Q H‘L㌣p.<P@ Op\ @ 0 0S T 6 #100#  0pS W0\ <0\S0 0Ѝ  >WJpP A?Pp @00P0S 4@00P0SpЍ ?0@-P MU Ѝ00 @^PʰP 0S Ѝ0@0@-P MU Ѝ00 @BPʰP 0S Ѝ0@0@-P MU Ѝ00 @'PʰP 0S Ѝ0@P @2 R /Q $2 R /p0S P0S //p@-(`@VP FR  P 0R0C0 U P V  ,z0S $l0. S0h0l0\s0(0~48s 0 0(dM0(8Qp0 Q 00U $QQ 0U $ S   R00 00C 0 0S 0S pp@ 0@-@ MT Ѝ0q P `PP P Ѝ0 Ѝ0P/P/ 0p|3P/t0S /p0S/p0S 0St0S0//O-AMM@0P05U0DH 0`5 0S 00B=0t?0P$0* 0 00@,00X004000408040<040L040040(0$ i<P T00 S S@00pC a=P #R 4040U RV RT &0S@ A=P  <;P@@ 4;P@ (.;P@ 4(;P@Y 0S+U ;P( 0SI# 0 003/PP 000S 0 # 0S R V  ;P  :  8:P <:PS 00,0S  003/`Pl  , 0! 2/0 1/ X0DS@0B=0 D0P l1 003/0D P@ 0,0S H0P (1 003/0H `B- 0$=AݍЍ L:P 00@ 0:0 00,0S  0003/S  x0003/ PPAݍЍ0S ,`:pG-BMMLĝ$A\@ HĝPBލЍP`p}=P   ;P% H4 00vP0 @03/ 03/BލЍ;00 ;( :P0S QP$0 0P03/ 5L&p@-P @<U+p@<+p@<0O-\MP(0,000m `0|6|v0p80  P` 0@P 9bP bbPI $88<@DHLPT <P_{ ut 0sU̅ XO  9P 02c10 @`VP00s0, us 00r   R1@5 Qn45 Q1 0\ЍaP 008s T<0 04:0YS lp0s40^  CRL  R0 r \Ѝ ;{PXX B9P[uP  29PP U0sP{ R rcPFPv }@0 000x1 0\Ѝ ur r  R  R P CBoTß PQ T+ NŸ+^,/"b @"b!"b! b Q @? UXӁ(Q~,;P{0<\x 0pbUNҞvOrD{>CcdPB0CN@awN1QN1S 066$%34 05Pa 0 # 3\&PW 3UPTh C2P00%3J D 082P0 S?  0-2P7H#0S0H31 /< L 8@@3 B RY P  B R3" P U 0m_P0 L Ri IY8@ 3 %#RO (0, P 0 # 3H3L#0 !20o 3 30!(3,3Q? 0 3 3 !20 14 S00 P 0 # 3$ CYQB0<S 0<P<\09  Q33"{I<&0 0BKP 6"P @1003/022 PH30H3t P@Q  0003/PP  81 P3@ PS2P H30H3 P< d0003/PX~z^ܝЫd[^P<(pC-RM`P@P.0តdP0%0 !ᔏP0!  3Ѝp 0`1#0.}    2Ѝph !@0P< 0g;`.,@0X P @P 2Ѝp(00 Qĥ,p@-@PP0M`"z? R0DT0#qT0KT0U 1R0[i? R0(E)? ! 2Ѝp!0 2ЍpQ? X L!$: 6Eʠ 2ЍpE$? ! w2E% $5 ;0 l2ЍpE* $: 60 _2Ѝpp0 Ԏ $? 1EϠE/$? d 10 G2Ᶎ?'fff T$dL0-@P47G W`0GW047/p@-@P`@ D R#*,-/3uNT 7'@P0  0 py^Ppy^p=0$80$8puN@vNvN@$80$8wN= @x|pp@-P 000 0SP0T0 0 @T0?@Q೐CQ%0  e@P0Tpp?CQ% 0#@PS㥛 '7/@-!~ M0P @? 0 Ѝzn 8@0d R0r> '7 Ѝ{n '@0 R0'7'7 0@-@ M 8 ?=$(4ǔ $(z.{.`p 4DŽgwgwgw g$w Ѝ@ '$7/R4' 7@047/0-@P47G W0@047/R4'7 047/0-@P47GW0 047/O-@Mp`?= xPp?gwP0<@08<? R0ß 0 !zr> Ϗ[@ D00 0HL@'D7 0@ Tß .a 0H'L7 Q`G @` p Ȕ垜̏HLgw\n Ȅ \`Ӝ>oN``L0,⃱ g? 0a=  P0Pc<`p 7 422 0-A`(,4WPHZ ' 7r q 1/pmW* WЍZ? R0[\!0 0P T0ތr> EϏ[@ D00 0HL@'D7cP0 @ʌ 0gVYpЍϠ .  0Ẍ`(,r> 薁  HLL @ D0!0 0H@D?H 0 `(',7Z{c7A?B@B*@@ r=Ώ1[@D@'D7H L0H0 ? R 0 1 #0nPT8<`#0f4 *:D4 '04倠4  H'L7Rq~J0"@DR0d 0> 0r9PX@! hl@0 [ `` ppV0 0 V 0⌰H嘠q 0 m 0 i47  q~r@ ' 7`p0!R0V0d0 !0`d  a p \r  HL @(,\00@08(0H0p40P0$0X0 0h00l00 0,`0 / p,@^ = RPX@Dg w᧋0\ R0id 0ᛋ 0喋hlaZ{c?B@B'$1S  噌r蔌q菌 劌 0 1/p W Wp kfP` Xhp0l*'7?r~4d 0> 0 9`dAV0.d0ǔ', 0*hlV0d0 ǔ$', 0PX .= R` 0` d00P0X00h0l00P0` X0h0pl00p@-7@TPP47 0 8p$8  .tO-PRM[ `@d1d0`00 p0U 1#'P P  Q"$ PUЍ R  bab9a( <0   bab!*9 bab!*9 bab!*09 +꼔xtR+/ p@-@BMP PT <0  @T""C CP000Ѝp@--010/@-000 00@03/P((@-$0$ 0 0@3/O-‘M\ 0` 0 +PI 2 @ t+˜r P0prWr0$SXWO020@D0SEx Y<0@po 0 9/fYR T @z 1@003/BBЍЍ6pG SP' W*0$SKW020@D0S0 00$S$ ˜  0 0C 1 p003/Ѝ0W00W . 0Pp}0003/@P  *d0003/0 Br0˜(0003/BBDD@-@_: S0::S0: 0"p@-6Q S @U` &1 R !R <U`p "r O-@0*V !16帙 E0TM6 RjlqI[]Ih 5S0 eV H;UPp00y5S p9l 003/ l{*Pl 0$pp 0s;P P P 8003/0P;(00 `0 ќPr TЍl 50 606 0 C$ 60 6 60 65S0 eطV | 0$0&; 尷p ꤷ (+ꈷ wꀷ U\p 0 ; 0P 0 P;0P0$08$0P &T  2/$0 T;8)PT K $s6L+00 X+,0` 04 3/(;`S :Pf 080`;; 6x:PH U` TЍH:P0(0P5SP;(0K$0 08 f`+H+B@ +9:P:S ,0\ 03/\)\ p50 0wd{:P P+< 4()8` @0<0]b! 0 bP0S  <zbPW 0S} $0Sv Yq 80S ( Ry 0 Rd 4 R] 4 0 0 $0 L( 0 0 <Rb,00X 3/0ZX;0E0<ğP< ᧞PEU[M101<bP0`p/-<0 ᶜP^ 0  0 0 0 B: 0: 0P*|" 4 " 0 ܒ 20$020 0}rpw" ( 20{6  0`p ;X000V 0SU 6 +060~ WV- 0 ;49P; [,9P +1 0+1<aPV0r X<aPl XP )p`X<aP `p4Z9P <}aP 6   0 0<paP Ďh$kDRHЌ Ȍmmhmlh=(H(j(܉Hk\TȊQpdTD8(dxdNcN@-@ M@ Ѝ `p0PP  ; @A-P`M P@(qPp  )PA  UЍh (P/ @P4P1 NPPP+ ;PPP;P NP PE܅X# )U 0 VЍ *PЍ0!1:ЍlVЍT0003/P  Q'50\h@0 P0@- 0P '000/( 0 Pp@-@P Q 0s 0~0Qp@T0!P@'Pp0 r ("( ("(0QpT0 0  qpA-pM`@@.rP@> !01C!C00 Pw 0Yv 0A1TYx 0Q1UA:Ѝp0@0@q P01CP`!Cx0WG-H`Tp |8Q |Ȑ\ TPQDD^PP_8@A0|8 _P000L/p@- @P4MLoP.T a @6/PЍp P7 QPPЍp@-@0x)p 00'0 S S Q8@- `8p4@LoMĐ(Pp. SR 0!a@6/ P0 00ЍA-M@@ APTp` !$A0 4/@ЍQ0` 1 & 1 &-p@-@PM M 6@ ΍P 0(( `0  @hLDۍ Ѝp@ Ѝ/-@-6BM@(1S ΍`@ 0!(P(P ; pB0P  qENBߍ@ Ѝ/T&;0;A- @BM#pL a H 00002'#2P0#2@u@ Bߍ 9(P@u@1'X X00sX0S,'< 70ᬈ0BߍPQ00Bߍd} @-4MNo @ Ѝ@-` LAM 0 Qk(0p@0 Aߍ&pW WQ00 ,'$ W80x0Aߍx|O-SM o 0` 0 0E H2D0  D3AS~ 0>p000\ pP U@1I#X 01 8/ [N TWPUp@T: 81  Qw F|>Q9 0CQ `>Q5 T>Qw m:0Q* 0Q# `PZ 6#06T>Q@ :=Qz =Q  0CQl AFQy 3 =Qo 0Q0SS00&` 06/|=Q 0CQ `=Qb T=Q 7 H=Q 0Qp0`6Qm Qf QI Qe @ Q Q\00C S0, 16`/QB Q *Qg F,Q }:-Q{0&S00 06``<Q 0CQJ D<Qa 8<Q  ,<Q 0Q$  6`S D4S0D4;Q5 ;Q_ z;Q  ;Q ,0Q0S1| $8`0$8;Q 0CQr l;Q `;Q 0Q;0000`$4` ;Q ;Q 4;Q :Q 0Ql;000@g ЍAk:Q i:Q3 H:Q :0Q 0Q0`3TQ Q Q :Q Q0 S 55`3+`#A<Q EQ JQ$ | KQ NQ0)S +`.Q :Q= mQj R Q Qx0&S00 06`|9Q G0CQi `9Q * T9Q 0Q\ `P Ѝ 0CQ;  9Q 9Q~ 0QE $9X!0P03/`0Pf30CQ\ 8Q 8Q 0Q+ 0 R"2`d8Q X8Q L8Q 0Q0`10CQ .8Q 8Q 0Q[  0`0CQ o7Q( :0Q, 0Q0`10CQ 7Q :0Q! 0Q   Q1 ZQB 7:Q QPE*W`lrkQ oQ pQ qQ0S4`+`bQ kQz Q Q0S6`+`R6Q MQ :6Q 0Q0`6A4Q 6Q ::Q ;Q0S,15`3*1 0CQ 6Q :0Q 0Q { wQ P Qo Qe Qn0S@15`3*0CQ 30CQ 0Q  0CQ[PU 8"`5P, PP,[`, (#`,[Q! /Q Q[ 5Q< 4010000 0@0!0 04`4Q 0CQ 0Q 0CQ0`$2Q dQ 0&S00 06`"Q :)Q0&S@00@ 06`@Qa DQY =Q0&S00 06`TQ UQ QQ0$00   Q$ !` 01v0CQe 0QV Q0S1`+`h0CQ' 0Q! 0CQ0`3[iQv meQ0S3` P0CQ. *:0Q[ 0CQ G0CQ[ 0CQ Q 0CQ6S9 Pc`P,U  ᜍ%yQZ QR wQv0S5`+`0CQ, :0QRj f0CQZ 0QN 0CQ]0`30CQO 0QB 0CQP0 L1S `Q Q QD0`: 0CQ 0QW 0CQ70`1-'(b'f'g'oN!((( 'MONN0Ods'''':(A(+N,N'w'x'>vfiu ''')' '''''uu'''/(1(N(2:'z'PXOuOON''z~,QV OQ0S00$  0$4`0CQg 0QV 0CQ n}PY  0CQ  0CQ0`x1i0CQ }0CQ; 1 0$ 03/;$0; W'x5`$;K0CQ 0CQe 2Q 0Q0&S 00 06`2"0CQ+ 0Q$ $0CQ0`1%0CQZ 0QL 0CQsP ( PD` 0`D4 Q Q Q^`V V6`060CQ 0Q 0CQK K2Q 2Q 2Q@0`10CQ 0Q 0CQ3] 33QA 0Q1 0CQ'0`1Q :Q0&S@00@ 06`Q QC0&S00 06`3Q 00CQ  ```0S6`h0&00 06` v|P 0&S00 06`RU6`2&0EBP`qQD`l * 9090S 1#0 D`Ye-T6`S0D1O0&S00 06`E0&S00 06`;0S4`5V ]0` 2+x0PS  l0&S0h0l0x0\Q `&d(Q d(  B 0x0Uf P6RxP x`V  x0   D h \ lR Ax0\ &` Rd0d(4|`0&S00 06`0&S00 06` &0S1`0`60`6] ЍAGfE0&S@00@ 06`0`1 0`6at6`S 4S04P 0 jP` 0`4Q 0 RI"2`v0`<1r0`3n0S2`i76 0R0`6`0`1\0`1XQH`S  90 90S 1#0 H`@ZZ0`30;6a 6`S. D4S0D4)_ ]}]zUxYuQ s0`  6So:P ` 0&S00 06``Vpa  6`06 Q:000Ye J6b 06D6 0R0`66 0R0`66 0("6`Q(0S4`0&S00 06`  zP + 0$S00   Q$ !` 01 H4010000 0@0!0 0H4`0&S00 06`0&S00 06`w0s4`r@0&S00 0`647`0047b0&S00 063SE`cR0&S@00@ 06`H0&S00 06`>0sP1`90$00   Q$ !` 01(0`6$ 0 R!1`0`10&S00 06` 0S3`0`30&S00 06`0SS3``SF0S6`6b 06:0&S00 06`0&S 00 06`0&S 00 06`d?000  / 0&S00 06`0S1`+` 00`30/Sn"c111` 0S6`+`0`60S1`+` 0&S00 06`{0&S00 06`q.Q0&S 00 0  6 0 &3`^e f`v#> R0XP6Pt `adq`G 3yP 0H$S00 0H4`8b0`610S1$8`0$8(b(6&S00 0`6 y PZ mc `P <ЍA'0`1<=0000` 4o `V aO=00 1R G^D^B 'V9fPU5 0S2  `PЍAvP*nPZO`P ЍAP",<000@g, H0S]  6#06`U0`:0 S55`3+`#0&S@00@ 06`0&S00 06`pW X`P7DPg0`P P6S :P7:003/`P 6S    0P0  000`   7t:0`03/ R0XP6Pa `adq`$a6`S 4S045000  jcf`V > SR SR` P6#X1VN 0 R" 2`0`10&S00 06`0&S00 06`c`P8ЍAo%0`10S1`0&S 00 06` r?`!10#Sv"c111`Vv`5&S00 0`6S6 0R0`6; 3 0( 03/;(0; WNt5`(;r0`(1n0`41j0`6f0`6b6 0R0`6Z 0$00   Q$ "` 02G0S2`B r ?`"29Q0$00   Q$ "` 02'0CQ{0`1 0CQWv q0CQn 0 R+`$4` 1Qa0&S@00@ 06`0CQT0`60CQMQ 0S SH0CQfy > 0CQ;0`10CQa 5 1Q/0S1`Q' 6 026`Q0`|60CQ0`;GQ0S6` Qx|QlQzHI(0Q0`1nQ0S4`d0CQY `M @ 8#8CQSSQ"((R05 5`3J*z AQ`uQ0`3n 2pP`j S>1`003/_"c111`Ye.`W+`R606N 90 9 :`?909DЍA$O1P003/ 1P&0 03/PP% > 9`PV EP R` : o@ /P h&2 &0|1 P &2 &0p1;`, x0,[S \0S `f@3003/0P6X1B:~:F;3003/0P6X130`03/ 0:BP --M0 0Ѝ Ѝ/+/p@-PP @f :pp@-@ @@- MP`p@P L   Ѝ@-@0@ 00l03/@P 0 0 D~(z~-p@-2P M0 "Q  Ѝp@ Ѝ/ R  B@Ri" 00000000 0  BRI  P E Q=*!3$ `003/`\P 9\``V  d0`03/P`h`  050\ R09P\g$Pꤟz~(A-0AP@ $1 R  `PV 0 6/`V 0S/  3/ph&$Dy\V9`P d0S pBpd0pS```\0`03/0S  3/@0@3/ 0`|z~x\ @-@01 @T 04//x R @-01 0S  3//p@-\0\ 00@0P3/Pp0TP0p  0Sp訛A-P0P0`03/pP |0003/@P 0Vp0  0S@@(0003/@8D0A-@P0p0 `P03/p03/@U耚p@-@P P@PT `Pp`p@-,0, 0 @0P3/01pܙp@-@P@0@ 0`03/0R3/0R3/Rp蔙010/ 0 P/p@-@LM` 0 PP 0bTC3Ѝp0C- P03MS@p;Q" P 3  :c`P4 0S1 #0S3,;3@T&$T$00'PT5*4 Q!L8"1f%PQP` `V cA 3S3S Q`Ѝ#LC 0`P 0X#c03%0;T`3:QA- @P!2PC 0"0 03/P ,a/XpP  0"003/P0 !pG\@pP,0b0d03/P C-0A01@0`Mp03/P0 0 P  0Q`P# 0 0\R/R03/0 03/BT /P 0 0 0S \/S0SЍ`Ѝ\P03/`䂇(O-`P$pPLH$  1 8#<4#$0  00A 0 0! 0p L( 8# Ġ0$  $O5A- PAM`d@  P?Aލp 0@ @0ddlx @aP@ @D, 0 u Aލ 4|4P4A-QCMM@C P?CލЍpG  0` 0/0&$0 00!!P(00 #$`G/. -0U 40GCލЍ30O-q,M @R` P0sP8 1 *PQP.[( 00CS+= 4 0 4 8< &SN0 0 003 0 q0[!0 ,Ѝ* ,Ѝ 0 4 8< ,&SN  0 30 0 4 8<3)S)90 p 0 00 耐R 003qؠ`J#P  X000%LR D @$%8 #(#< :00*#*)9 *ĠA0B=`&8&$* &l-,;.> ?0@`+< $ q `@ 8#<4#$  P0/ A0 "  ! 0  8#Ġ 0 D;0N 0 4 8<631S3/79`139V 0#0Sh8  $ 30%0 003 000 0 080 0 #cRN 3*0+& 4 0i]\ ^a`0_b` $4c(8 P00 0 0 6 I`H JML0$(K`N 4O8 k? i? oP01ࣼ;!0P01 ;p s  ؀` 0 0 0(( 0&&!`0(&l.pp"#$`0>  00 耐   0PG0 ؐ 0  0> D 0 7>*!Nb//O- PMM`%@"N P?ݍЍ 08@ 8H 9`p 88!s0@o gi0e0h0j0x0y0z0r02kl02  m}fwn0o@q@`a[ M@V@ `@ CH >@$Ġ 0s{@|ݍЍ *$*0@- PM"`Rp 0' PQP@: @T 2S? S8 0 4 8 0Bl1l003/0 0Z- 0\ 0 0P60 嶟R5 0B2좇" 0 # 3S ` 0  #  P R<2S $Ѝ/& \0`00 3/ 2/ ? 2/؀|S/p@-M@`P5PЍp 5P 5P 0 S T -S PP0 0 0   ) CP00 0 T@ 0 O-@ `@%``1`!` 0 Æ3_P \; `@QP?oP20S( 0S) =S 0  =SS;S00S 0S;S u P0;S  K; Q P 0  #O0xA-@ <Tp@0`3/PP P@P 00000+P@0>S00|A-1 M @0 P  p`Pp R p 0 `*P0 003/V  0 # Ѝ$  0 `${xC-1`p,MW@ P\ `V 0S 0  {`P!F3S, 0S^ R0S  (F3S1 0 !0 }`V  0 #,Ѝp P\1 0 R0$ 88  ,! Z` s* 1003/0S R00  E`00 .*P ** R0t Pd\ ThzTx8S,SRhRR0O- #LMR0@0 2`S08@008<0 08P0,08 000|80$0t80(0 0 0 Pf 3 S <@T TK] 0C Sfqz`YaA"0DcS1   R  PO LЍ0DcS7  LЍH8!0 ' 0 DS cR& 4 { T. SC 0 S0>   D0:PD0S S 0  3S LЍ 02Ss D0DcS 0 # 3S Py 0DcSk8 +H80 0DcS n5Sd1 (3&% 8P 0 #T 08 #5T  i7 LЍ<0S 0C S񏐱m`L&!@ H7$TTh  =8T  5S  1@`2@)&C  00 0Sn@C0T0@ 40 P400D3  40 P40~  40 P400F3u  $ Po0 G3 R1 04` D0P`P B RU @ 0 0C0S@#23 @T 8P D R& PEU P4`0S8 H8 0 0S:  3@> K0@@ )$ 0 C 3T  (40a P40j0E30S 5S d! D#RGS l@m+ R' [7 0  40T0P 0S 0S0u 3ETcR^0 P9 0 #0,00 P+ 0 #w|03">PE[@LTxL bL)X XT O-P,vQ R pP 03/0 3/`;pF3S,2Z0 20"W " P- "   0`0 3/ 03/03/V 0 #:0S1`V &`V00S 001003/W$&PD 0& 00>@2#.0` @2  0 `P 03/0 3/$1(003/0a+!P B`P`C 00j:Up0 003/ 8`P $/&P! 0+& 00Pnh dE DE  E  4     Hp@-M`P@P0S 10SЍp@ 0!ЍpO-@2尸M[00q+ &@ (  YP`Y10 @ 0R% P@Y> Q RR0 0 R R0p! 2/0P0K  B PE QP- 0`0 00 fPE`@YP0` V  B PEP U 0 尸0 03/ QЍ000 0` D0003/Ѝ(g x@0L !S / 3/O-dMP `L0@Q@瘰Hx;00 S005 2! P&[ H& D@ 0O00 I D4[@ 0 00 0 pp 0P , R   +Z Q񏐋U>~a nP2 <9<0( <9  0 R  0Sq @T@T 0S 0@ 0m0 00000000n0X00W A40CPK:P dЍ 0jPQP`P0S  R  B0  0  HPQP?0 Sm 0C 0 dЍ 0 R  0S;Z0AS񏐼xe@ 0 i0[ @2 0@Qp  dЍdЍk { 0 R  0X0r @0 000 XY^ i 0 pQ cNY]0  <G\0  L*5[0  # [  0 0  @a+o0SPL0  `>( @  H $89<8O-QM$,lQ hq@ @ H 0LpHhvp Go00CSL, p! R00 S񏐂VBe}Ri }\ 2 0WSpp0   00Q00   p  (  PQPw(0W pG`Qp` 0 R  0 H$0 PQPgP$0AS?,L $0 PQPP$0S  R,0S< 0 R  0SW 0 0!20 P p 0 0D 0 + 0 R  0 SZ  O Ep B0Wp0 W ,0W 00 0 B40 0` R   (0 DPQP0( S 0C 0 Qߍ $p0 8PQPP$0S 0( PQP0( S 0 `Q H jkP, <9 0( <9 ],0S Z ,  k &` 0 Wp0p00S S0 00Pph 000,ki(0  PQPE0( Su  $p0 PQPP$0Sx  R 0 R  0p!0W p@p00- R|  B0 Qߍ R0S 82Qߍ% 0 `Q ,00 0mp 0P R  ,0SE0 0  P B0 p  KPS pWm d,l,0SPt, U pN 0 G e00 0P . p0 000  p (0 0 p00 0Zp0{ Z! ]0S S SH SK  N 0]Y0S" S/ S Lg< !1 R +  0Y00 0 R0C \000 0 `p4h,h<t(dDL  W@-0M0@,(P^ P,8S> 0^ 00/0ЍЀ,808,(”"l!!?P0 0"b@-(MR@ 0(0.00Q0T50S2  Q  T   R' 0Q R 0Q0T 000S  0 0 0 (Ѝ p@-@SM` RP 0 U0S V 00 P`@ @Ѝp0 0 0(0 0 0 @ @0@- M RP  @h0 U R 0 0  Ѝ00Q00 Ѝ00   Ѝ0QP00 A-| |  Q0  P@` "T0 0/pT  0  0 pp0 Rp 0p0a0@S @/ R0 0S' @- R 0S aB \ Bࠁa@CT 0C0S \ B a0@S @@oa0BSa0BS B a0@S @@o/PQPQ/\, 0@-R& aL^ @L @aPC@U 0C0S \ B 0SR aL^ L a0@S @ @o0R0R a0@S @ @o//R/@ 0aC\ 0C000S/Q/R/@ 0AC\ 0000S/Q/Zp@-8080 0`0@3/PP  hpTIA-PPP0P0@0p3/@@P@T` 0003/IbPmahd`\XTPLHD@<840,($ XT OLD@>:93{wsokgc_[WSOKGC?;73/+'# 0/(/ /////////////////////x/p/h/`/X/P/H/@/8/0/(/ /////////////////////x/p/h/`/X/P/H/@/8/0/(/ /////////////////////x/p/h/Hd@t`D lD (<Xp<xPtD lL h@hp0`8tDxX0d, P3 !#/////x/p/h/`/X/P/H/@/8/l|H4P L/D/</4/,/$//<HTDTlPwrnjfb^ZVRNJFB>:62.*&" l/d/\/T/L/D/</4/,/$/// //////////////////|/ 04<4d@d$l$xA-P@1U- 0PEp` 0P P 0@S P 0@S000W p0S$ 0 bA-Mp@P 0 `P P _$P0-SU@Ѝ U000"S 0S ЍA-1@PSP p`J z 0|003/q;O-@PgM| @ @ 0a!"t0CT< "2  "匢  "儲0  嘀Pp    :'h(@T 0 Pt PP   ( :⧜@(T@gߍvP :  0P 0U  (eP Pr-*0( TP%08TP+ P: 嘀1 z _PP0\8z @\  1@z 0<gߍh z{0@L zs1@p@4,P\@4(O-1,MR0 0 PYp@ 0ST ZJ  41003/`P0+ 0 Q00T  @0 p00 0ᴒ P 70[ 0 0 2/ 0,Ѝ 0J0  m0@?o T20S0 `0 8QG-`@P #<Q # UPE,Up] 0'S2 C Rp#p !0S,U 0$4G 4" # !EPpPUUWpb0P'S 0S  R?JCx0#Sg 'S Sc U`rPp@ gT8G_0SXUrP p@JTO  RH R @;050/0|)'W= GR\ 'U+ ER"81801  |0 0 G001   00!00!p11llL`T4.~L.H.@~(.O-@`M M| <8@| @6A@> 2 .P#U 'U5 U ލ ЍK@ 0 #N0  @P0 9P6@ 0 >ލ Ѝr-0A04 <> 0 \"N0P0 lLT 0"80  $"$ "(` , 4 P`@T  P㓎Ⱐဨh 0 PeI   ` 0 7@PT$(`e@0T!0 0( 09FP16@q 0 >5kK(@r 0 N0  @P0 9!Pn g` 0, P` H S@P,T 8<0L d0Q/A- 1 Pʃ,.prM!$z=$4`'80MV ,>4p6 0980>VⴎV00ⴎ0>V >VÅ>`@>~9 0P 75;09 PЍ0C0C> (ЍA  }< @/R 0-S M . S/ S S5 ? ЍC\%0 0 0200'\ ʘ Q $ Ѝ\ hT00L00 @8000Dl'@'lXd($p@-P` M@90 P`P40 Ѝp 8 0O-@P0M 0$|;`Ht+0 P `03/P r-:4 .XTXT TXP6p`W d 0 0P0 L8 <0@ D0:0H0:0(0:0,0:000:040:0P0p000 DpS Pq 7n Pd 4$  ,QPk Pd0S@ /0 @ D0d1Y { 0 `TXz<PS\TI!h` 0> !?P07@[ P *00 0 ЍUP U z->4 S *>R .PÅ>r-0C4 >.0 HG0<0ES񏐶U= U0<{`Y 0sTX  0I PL00S L0`VQ[Pp<S (W `pPV 0S!!Q Q Q 0 (\0011 RB R0 R 0<0 ,C11 R9 R/ R(Rx *(Rk  00 '001<S S S0 <n0 4 <S S S:4S<  SU0<X z=.40S0>P…P0U,) "0/00xW 0i0L 0P0dPS 7P1SPUp$j: 6/Pd P R P P$ xs dd08 /0 8 <0Pz->4 S *>R  Å>r-0C4 >.{ 0F Px TP 0S S0́ 0<*0S S0<0*0S S< 0S, S0́ 0{$R R m $R R  $$R R $R0 R: L 0,P M.z=40S00…0 SRD )0 00;0`P 4 A B[/,X$30G`03/`Gߍ`00Gߍ`<Gߍa 0 0` D0D1 Dx" 0 `@ h6  i6   QP| " @ D1 1 046P !81 @!0 @D 0 4 ᄡ81 @[D \1 0 4 PD 0 4  0@[D 0 0 4PD 0 4P  0DH00000P ,,p 00003/0008@dHpX0@- S LL  M@@@  cGWWO- 0OMB p/o"P08$08 0S$00PP0S000^ POߍb 0 0 PP p P 0Nύآ!,4!8`@0 @ (1,S P@0A80C! S6P O?008#8 S0@ PP0 ,A ? 0)P YPP PP 0i Oߍ H*P<410  (t,ph 0$@p 0P 0#SS8S#41   nY}* `G  P@ @@PVvPF uP P@@PVj: P`d 0 I  ;@P  3P   0@/6 Tj  ?0P@40 6PZ @UW Q4P ,(Q,8xL "0 000 09! .$@(,p*  GP GP0  GP   GP  0 GP bl GPd (RLR\ 0A- p0B`TPp 50S PQAPA5PBT 0rG0@-@ MP:00#P00S Ѝ0TP* @-M@8P  <?B3c Ѝ  ЍMbϠ0@-M 00_@S_ 0 0C!?B3cЍ0Mb0-M 0<? PA?S% 0@_ T?Ѝ0/@BA-@^`Pp^(4K@@T@!T Q(4 4;04;@-,0, 0 @03/PLp@-@`N BTP  P 0:0CSp@TpL8S /G-H[MU@`Y G0S,U& Zṱ 0 5/PᰱU! U) U0 =Sd pPЍ0p,0ЍSPU1 `F 01*p00Ѝ 0H2L0 0 000pS1 0C1pЍ|pdp 'b0㳞H; k'4Y63/P Q UJ  cpPJC H[|;qp6q@pqpH;S9 ! 0 p 0` @P V.6S+ HY0H;&H;S 101Ya nP]*p! ' ^T`ᳮ C'4;P VS1 H;S & 1HL01&&(8|$| f8p@- 0M""H“ ""0D 001#0 ! RXQU PЍp +@ BR3\aV 㠰P\ 01/`ᖰV  AP!R! ㈰1!3/P xU  AP9PP `P 0P @AP ZpP  Q #@-R@ 3S Q<?l<0l</Q$mm 0d "2 0d /aO-dM(000?$ 0 R00*:匣XQ\" SZ@P0Zo 0 prW pPS 0 03 1S\PRL8S !1`0!SZ H2nD0\P`Va`Foo b @P>\@Ti V A+;6@% (R ` T (10 S 0 `( 06@> SR  0*:H@P<0S| ၽPg *@dЍ7@dЍ0HhPd@.`  8 $ @L 0( DW004 p,00 QPĘ 10  P0 R\0 0X 1SU  H2@4PU W0X 5/P W0S1X0P S00S\ &1SQH2 D00%0@1 0S~ 8`o%<p%< 00Sp 1 L0 `p0 QPY X ?RL0,0 1  P QC C0C?QXEXU 0 0R1 X R +RPU'H2, 40RS 0Z00 H2D 0x K{ PRp40 (# t0 0 H⚻R&#xQu X0Sw0X0 r1 0S18$0 `p`p~X X 0  =QP> P]0 0 X0S# {$HP Y0S 0h0 `0XP c  mP:H240S 0 R0\0S1tGP4 p0[ 0S $00S@0 PpCH@0W@P P@P0S<6'0 SR pSR WV Q 1  0S t%@k040 p0P`0300$ 0dЍdGP P00 SRg 7'P0p0 @ P@2\0X 0X0o0Ps0 00 0DX ? R1 T @8 1H2D08 1!\P@P0 \0@_ G?0 =S > QPF 1\ S 0C 1!H@:X0S W0 03/0Q3/0Q3/0 Q3/ Q0\3/0t\P3/0ltP3/0plP3/0xpP3/&xS03/gS>03/0S3/0Qp@/O-@$Mp @@@kT`P@P ? 0P p P`4@p  P p04@03/03/03/$ЍPh 3000p 0㤰0@0 pP Ppp 3@p@0 aP PQ0Sr D3@03/ 0pP003/pQ{ . 0pP0 20 20 5 PQ (0 3/Y0 ?A0S> @0 pPB p@fP 0㄰02@t ౾1@pjMPFP?P+ 0Sl1@Đ,1Sl1l!Y03/PP0[S- Pp7$1$003/Py PP 0000#20#Y00S0S S 'p@0T 00P` =0@p$p8,SC-PMp`J? @0/|B쁖ȟX04> X 0/mBȟX0H280S) zH2 803/@aЍ0 Žp@  Ѝ0@ ᳽ 0裼P0l2S /p@-@PP @pp- 2 M @00, Ѝ !2 h lG-0 0epP`QN03/pTpgn`03/pX; (+ 0$ 3/;0;0#$;G躃0( 3/+ 0+G-@P  ]>4!r 0!r 8!r 03/;a`(k0H3/Hh0L3/Lho~,&d>0&NLh0 3/0 k3/k0 x0S  x 00C0 `0L 3/0P Lk3/0X Pk3/0T Xk3/0p Tk3/0\ pk3/0` \k3/0d `k3/0h dk3/0l hk3/0t lk3/0x tk3/0| xk3/ |k03/kP !/B +1x03/a. 03/P 03/X0( 3/;0;g<O-M@PYh3hcP`+ЍY  :Z P1#80S ;P PpY:X p R0H_  G B XX i H B ZS@@eYV R  8 R  RlT   0 0H"003/@@T P } 2 003/@[  @P l1@08 03/80ЍX  PXVX # 3R0@  B BW p8 R PE 0@ B B !0  2/@P0bT8\0p~ 0 0 2/P 00P03/03/Cl 0 0 2/0P0 0k<0003/1X # 2G0PzC-` @ M  H2L0p  0  Ѝ0 p   *:01Fs P   ̯d1H2D00  00!206@o0 ЍrD o0P +A-M`@PP'V !2@0!2;3";&0;0`p ; C 01001`p 0U 0ЍH2L0 ;0;O-@PM@`   T0 p 0 0\@Z@[@dpd$;刟S $@ p?:`08`3/@P P/0  `3/P6 0` p!P`014181<1@000H[>h5%.#S  000R  ! 1#! !2 "L. +B/o 2l"00P 2 0S 20! 2t| Q!2P0&!6"3""202"24001qpqppqr 2p 00  400200 "4&16#" 0 0<X#2„„y4P t=003/PN Z?l1!3?18 <06&J?R ; p` V 05S $ 9 Pw W6&@??#p$+0I0Pv 0CS+ X4P T<003/Pg P ,<003/P] 6#"10 0#2 2]h5S,0 ;,003/0P,0K lP4 ;003/0P40J 5S(0 0d`D0(00SH,04 SR ;D03/,0S 3S ,03/40S 400S H2L00,004` 03/XZ0S H2D L0 F 2C90H2 2 0R 2 20 2 "!000!2 ! "03/03/L2L0 20 2@1S +5S 5S 0 3/9003/P  "20"25S ŕ\> Q ⧹PSt+Rr 0 o0Pa 0CS@( XBH2L0  !2xh`1S 1S 3 S? 7,0D070H070L07000704070@0`0:S* !2 d 040pP`  ] 2/Y 0`:S !20!203/!20!2Z,0(0p0:S :`P 00! h0V0Pv00(0(0S0S , 7003/`P 0[S :Pp 0h0 0R pX  03/PL 03/0Sa!20!203/w ,!20p !2ݶ\0(0P!2 2!2 Q!" 0!" 20 2H"0S 3/PjH"0S@0#06#10 0H#2L0LPT 0 H2h03/P02,P>P H2 03/X2l2S0 0Ѝp` ,00SP H2L``L40S 400SL ,p0  03/XI ,`403/0,3/YX> T Ӑ  Ѝx R  x (8R, 0 v ; p H2L0  &@#20#2 #20#2[0S h aYЍ8@"#8hp0  0 P4 ;I;h 0;$+ |0 Y0P 0CS(pP=0[SI 7H`@X ` ( 0.Sp @H0` `F` P Z  V.R `Xp(0p`X PXx (00 X  P 00 .Rz @0pKW(0(<``X8D_,Y4(l-0P|{a~~h\y0y$xwD{tz\|uythxrv,H2`V< nhp0 `V B0P,0i  ,0*0D03/,0S040 20 2;D! 1003/`,0043/,0S 0,`$+0P ;;$0;xh hP @P10|Qm {Wg ` @0P 24`,`]2,03/403/D03/ 9P6S PBP D0|& + & ȴ[@0d D040,0K 00S YP PI!2p0,t| !2Ⴔw!20!2(0P00S H2D0S0\`0hp0p0 P 3h 0 03/pPj !" 2 !"h  0!" 2tp|ph0Ȁh0 0 p=h00S[ S^ S 0X 1S1S|4t 003/P2 Q )Px+R 0 0P 0CS3P% 05$ 03/ t;LSHp x;屮S @0 p0P S 0CS% , 54 5!2 `03/0a3/!2a0!2TP  ˵P h64`,`l 0pP. ⸵Pe 64p,pY 20 26$ 03/ g`0PD0 Dp( 0ᐳ5d`S  ( _Xg`]PZ 0H00@@0wp DP 7 03/0'; =P\ HX70w00(09<s$8P03/03/03/ 2 0R 2 `VW 0 `3/0`0M 20 2L8 003/P 1 0 0Pf 0CS<( 1S8x 003/P4i`hp ; 0$ 3/$0h n0P 0CS) 03/9003/Ph T PeH2L0 00 h0P!2h0!2ҴP }@ P Tj`0P,0   0(P^ uP 0{W 0[S :003/P\ x6dST0,  PHH2 L0 00 h0xP8!2h0!2₴Ps - Rt  BR;0;003/Pqd5hpdB/0p`0A`hӜPd5d R  @1S +  R=  BR_L<0E""!2 0""!2Pp8P5 jP0.S:S %S! H3P LpPP sPLP0~S_S  -CQ R]S0p0G:oPDp hYh0S 0SP : 03/1p HP 0h3/0HS. ^ n`P 5SD0 (0d`D 0P,0 }|>|00 03/\ 0Y|%5h#3%5 #d$3X&h4p6ŕH$4%5ÅTX$l4\&t6ptlx$|4% 5\L\$4T%5d$`4%H5($,4XP% 648#&<4`6@g0$04 0PM w  0PF `0,0x0S  ,0(8 0 x0`Sp V00`㠩hPl0hp 0 (P  l l}d|P!"!2 0!"1[00\ Z0P * l\`hp 0` 3/03/W00U0!"!2 00!2 03/0q3/q!1!1qq 2 "0 0 2 p03/0p3/0p3/0p3/0p 00 0ppppp03/p03/p03/p03/p0\3/\p0t3/(0tp\Ȁtt00lȀ3/lpX l0Rl0lphp ,00`0 t 2 @0 22/03/ 03/0 3/ᄃ<p03/倃03/03/\@!2@  P60QQh(8vP\!1p"t2  "@w3`S$0E 80  2/P``7 h$0#"#0` 0Q 0\0(0D (\ 2 W 2 R!2u tMrh R   0`3/ \0(0` \0 (0!2E\ \ ( ( t000h4003/Pl/ 0 ,0 6@P! p ` R ӯ` 0\0(0 `C7'Z ᾯ` 0 0` 30``03/P\0l(0 0 ,0 ?P\0(0 p ` Rw \0(0k30&hp((0 RP 0R:x0S !$0S$P9( 9 pD9099( 9 <6 9)0 9|$0SP dx0`S V  0h P3 P 2)H \0(0` ` ztP !20!2K 0 T p801;h 0;$+̮,`0 }03/X 40,0mX``0P,0 Dphr(rqq4o,o nmnjXjp@-@0 0P03/03/03/0 3/03/03/03/03/0 3/0$3/0(3/0,p@/᜙p@-@P 0 0 p@0/Ḙtp@-`P@@?/P@P U T1!pP@l0P p@-@PL`V p  pp/k@-@P ;P_oRO-P@``0S" p+% ?SpP00P0S V SW2000000PPS00 PDkO-PLM;@q[T`p ?V` LЍPLЍ`@@0]SV4 0%Sl ` PE0]SS@ `]VV 0``0V]V   S]VH00 C 003/P*  ` p` p  PP .0 EP Y` ]0 0@TLЍ `=pTj(j j@-@@4 !G-Q00P` sP-0D+TS`(V p@TV(p0:S@0/SY 0P0G 0sS bO-M`pv<\PP`Ѝ<0@003/P(" T0 ) 0 P  RP$ K PT`$<003/P`00`$0 /Q  R` 0 /SY`00 R9 /Q#R@/R#S 0S T `  ` ~ 0 S * 2/P @` `V#P 00 ;P`o0S?P 00 *P`^H: 003/P P`P0S > V@r 0,0 `Vv 0@,000@0P 0@S 6 D0PB L0;@0,`0  007P,Y  P0Y  P@Y  P  `8,03/003/0@3/0V00 0,`+ 0P :i`P P0S`Y) P[ P %$800! `  . n'  2/P /R @) 0A0CS0|S:S00  \R/RR[ 00 00 003/`P  @,`` /R @ 0 0A0CS0|S:S00  `y 6 003/P$@ @/R A BR  :R|R /Q\Q  Q  R < QP @ /R `A DA`; @`8tP\ 0PU0 0SQ00%@` 0 $ @?=<908  PP `0 0LЍLЍ  .8m0BA-P,p@@p`0 8TPA-P,p@@p`0 'TPA-P`J@Pp v WR 0V EQ   RR00O-WMA P000@eS`Pp $ 0  P <( 1 3/4 003/ 13/Ĵ0  gP #(p 13/4 猠03/1 3/ 0 SR L40!0HP P ^PE 13/03/ 13/Q 0  "Zx  13/H 03/13/ 0P0S  \S"S0S 3003/`PT 0 S \\S"S00 0S00 Q0j  PP00003/U$  Rw H`03/V  Rl P03/U 0a1Pi!00Wߍ P Z  13/ 03/ 13/>E ! 0P D$0 0  0 *0P 00rP E13/1 3/ a 2/0S   0 R.`PlH@03/T P ><@;x<A-=\\ @Q \=\=Q "\@@\ Ppo`"\ % ,\ \\U \P QT  P\ \ \P% P/O-MT `@` p l&0 LPPDP =Pߍ"`$> 0 `@0P > <00`,0P0 @0P "0n0 @0P  <PPp5P003/0P$0B P0  (0`P; 0%00 ,p04@8p(@ u`P qPPkPP8ePP4$0,p$0004@3/ ! (嗚PPd40,0@a`P Ht Mp Ua Qa< @  Ia Ea5p0 40;a?a,a`P  1a -a   %a !a(pp a`a8ps@`p0 7Y` <x0P00 ,``P  ` `0@x `40@D0``0  X@,`@Pk (b@` ` ` S  ` ` H  ` `( <  `L ` 0  `` `D `04@,0`4P8P0 X@,00` 0(0< 0 0`4PD@$003/T 0 0|$0003/P{L0$0=P03/t0;$;dHc:9999L9 8 9,J IH40@-M,@ @\ TTP @@4@( @0@@XЍ0P \lpp@-@P0 0`03/0P3/0P3/0P3/0P3/0P3/ 0P0P P 0p[0O-UMM D0 0\5\00T5TU00L5D 0 0@5P`0045Dp0 0PP/0 f@P P( 4003/4003/P> D PD0 D P PD 0,S D P PD P 0zP  0 0 0oP 3003/3003/PUލЍ Y0P0 3003/x3003/PEP:  <3L 0(003/0P$0 F3 000,.PG "00 04P8 <2003/,2003/P PM 0 0M4P080 @ @ 0 103/ 00 0 0 S=*0S@ 00 0 PE  0Q0 p000 J 0P0p000   0Q0 03/0 0 0p࢛  P] pX TlR)4)t((&@-(0( 0 @03/00 0LPRR0@-|P MP d@T D0 0 Ѝ0 0 0@XL<&&p@-P @@@`P@ (0 0pp&KQR0 Q  8R $ /%%%0P p@-@T P@PTP3#p(P0@0U#3pp/`%A-@P@`PVpP`sPp : P000A0/`4fxJ$@-@@P00e 0/leA-0MPPUpp `@X@܍ r p R , B @@!D܍p܍LeG-(M @T `p0FP/SЍP  D 0 @ I0J0#20Y 00J0BG 0 pp!VBCp 00C N?Ѝd#"P# p/h/`/X/P/H/@/8/0/(/(","0"8"D"T"\"h"t""/0 Q/+@@-<@M@PЍ00 ȿЍ`@-<@M@PЍ00 ᵿЍp`@-<@M@PЍ00 ᢿЍ$`@-<@M@ PЍ00 ᏿ Ѝ_ 0A-B R R# 410S`PVUpXP    A4!  2x1S 410SO-0B0S0S* 410SPfpw`WVZP 崿 尿. ! 嫿0S  O裿41002x1S 410S4x! R A-@Mp`@JPP d w þЍp@-2@P P@PP վ`PMp`궿@9S @-@ @ 90@9@pnG-MP@p0J0`Z@ЍZP UPQpM0@S 410S 0.pG00TGq! ` T p 0 `P@ 41002x1S 410\@ម0 P0 S jaPC-CM M`ĝ`@T \ PCލ Ѝ Qp`P >4Q8 0Q40Fd F/o"XQ X X~ lX  `0d0D$U <$ 4$8 ` ) PL:U X4Cލ Ѝ30Q QG `3ȓ0 XL X VKQJ $ t`h``T`H`<`0`$``0 ᛗ2020}"0  ǿV 0 r꼒 `R `ꘒ X  X CQrmhbWRMHC>60\C`*P`&D`"8`,` ` ` ` ` ```` 긐 }감 ` $ @ h (p@-P@ᬿ@PP ~0p@/pp@-P@ᓿ@P˾`P f0p@/ PpA-0MH| L`Pp@ 㹾V E 0 | 0 90 q0Ѝp@-B`1P P1P @-M00 ⚿@P T t PsP d0@ SЍ0CЍp@-@MP`@@寽0P*. J 6 @0 00 0 00 MЍp "0Sz` 0C/!b!0Cb J 6 @0 @0` _ON@-Qy㵻ǽ6@bRA- @p`PtV@ @9S @-\@P@ @ $  6/@-0 MS@  ᘼټ击00P <00 Ѝp@-`RN`!!p@O-QMP p PV@0000 0(00 0p80` p:9@ P1 8.4 %$(P!$ PX$PY p 0@r뻺Pp @P@@哾@0S ߺ뫺P 0Z뤺P#QߍQߍ@@p0S 0S@-@ᑺP p0S  P 㶺낺P@z/0P R/|@-@P \P @۹P *$ӹP+Pp@-@P P pBP "Pp@-Ľ0 B_덻PPPP$O- M400` 0V0p@p00@0V:PP ᶺPP0d40૔0 3 Ѝ<4ࡔ 0$  3 Ѝ\@- M`@ᶽbpP 8 ּ0@ sX 80PUP! ]00Qo Ѝ0p@-@0,PC0S0U,D00pC-`@ P0AMrጻ`1V ! @¹P0 !0Aߍy0@S0,ٻPP8U- , `ᗼ0 @70 !0Q0 !0ꧼ <S:#:S  'P᫻0 , ۻ `P  `RX1Sx1S x  4 O-0QEMPbr 0Sv 0 @衟Lp 00! ᵒPF ,{P+ )&% ᦓ@T&@X  Eߍ4&@ @P+ P9 PP X@(0 ᚓ ዓ @h] l0 S Eߍ,M 'X      O-0bWM@Pp~嫻PFXf rP8 P6 0 \X00B\1巻 <S@{ X`T0S d`@0L  0븺00X0Su0S  @#@0WߍB\@Wߍ TP 0SXZ YX ¸0 㽸00 0W0C\1)@媹붻0 ὒ#B@ X AX R1 0ᮒX RB 3S@{WߍJp1$JTT X`*#@P ඒWߍP 41002x1Sn `@m}养P 0S" A>0? X`0 v<@fP03X`t<@004100Rx1S = 0#@P X   t C-`P @0AMru`1V ! P`PAߍdpP  X5Q0 !`0꡺00o@ T@@W@T , `l\ 080 !`0, ι `@  `qp@-@M`PP @ P @ /0@9ᗷP@Y ܍p#X R<0 ޑB܍p ֑5܍p<O-` @_M0\ LP/S ,$ P1 d 圑0 D$́4 # $ ($X( 8 S; 10 04 0 `10.pP 0SE A>0 Y 2#p_ߍ4  "x!R ܑ0 $4 `$ x$  $X( S S!4002x1S  2!0 040! Yp41002x1S = 0x1S0  갶뭸 P 0 !1S 6@Q H4 0̟S,<  0Q Q Q Q P P P 0 ַ#2 0 RS(0S00S  0 S8  ,4<004@044H084D0(LL*P00S}0S  Y 0 P Ԑ;p?  "x!dR0圑C  "x!DR#4 =x!Ŕ 6 ౐p#x ᧐p4!  "x!R& 10.4002x1Sg  Q|*t: 0xQc bXF0 @`1PE4$#V"#Y ipD0S 8f8YY >*Y +Yy0 h0R 蘷0P(0 (ƶ(Y ޶h00d `0D ᰶPx< 2 `:p*p40S X_ 0S 0Sz0St 0奸᯵P  ϷP| Rpi0` #2 D^?!c  80宵( 80 0P ڏ#pE41  "x!R~ 4<04@04H04D07$ |X 0S 0 RS/0S0G㠷0S H4#20#0 R00S 05㎷  p0&,[ 4S gx 4$$3/^xX0P GP+ 0S 1#10ShM0 00 P  P ᜶4S#pӾ 0H冴H8  H87!P c0S  0H\0jPj0\匷P`X떷x #pY<0SJ ]0P(0| 40P0+D0 (z0PL0 L8ַtoYPgL(寶Y]@0< SR H*P =+P600S>( ׎@ P 3 0 0hl P\Ž41002x1S0S 0P(0 ㏴0P  8L0| L0L ([L R x ᕎcx ጎZ00P(0 ̵0P0 0 P$ ᯶ 0S   Q0  4(P 40Q (奶P1$ 痳5002x1,$S04< @044H0T w 0<00Sb 臵0P 0 Ye ㎳0S 80弶0Q Y <0SL H0S<108<  >80P 00 P` < 囶  , 唶0S 啳8巶Pꘐ %CCKK <dhh@hdhTH<H<4`T@X[|X[[lZHtd8p(|`hThD0SU < m0 "P9 0 Sr @|Ph 0St 1?o2SX PR0`wPMtk;p00 h0@ QPf lQ^ 8/P Tlp M+p y`8PD x  0PP0װ < Sz:#:lSvu儲0x }bTP}T0cͳx, T"*0P(09 0 lPl C(0S90 0 68P, h0Sg hePc hv8厲P 0 8P 7ꅳx8  'Td P LO-0DMS d00h00!200 0   㞰Pq 㘰P00PP00U 坲@P| `Pw3p0$0R* UF  V+ ; RUΰ ɯ P :P @ 0 |Ʊ@DЍU(  VṱX@ 04 @P a<@ DЍ唰 可U0P0凰傯0S  AP $900B@,@rPPW @ `@ oPt* @P$ ͯ PN ,%P,P@ yU x,l1,0P<@41002x1S) 0000($1,0P P P @, ,Pg CDЍ0, <@,,P0,0<@,PPpp vP`,  ᜯ ,0 DL <#O-MM@$ t 0pr뾲j0P 0?0,0Q H4OP  0/S   |n 彯P y p 0 P0P@0垮0 003/Ppl 0l7X , >0ZP03/-  PP 10 0 ZPt  ' 0 $ 0ލЍ*0P00L 38 V @PE뤰PA 80SHLp , < , @ p D h  0X@(< P 0 ၰh0<  > 0  v@< 0  jh0@  ' 0 _0  Ů0  R+h0   0  FT; `R 0x[S@P0 ᢮0@TP 0 *,+h0  0 (0 @0喭0  *h0  0 0 0倭0  *h0  0  $rPUD > B4P 0 s߯l   ܯPWU9ᗭ`ȯ@P1  ᜯ0 P0o41002x1S L) R41002x1S 200  Ç0So !R A@@T S 1P0 ᓰ@P{ MPY 0S 0S !x ࿇xٯSP ֯0 0ލЍ8 இ V  ஄v41002x1Sv !uP{ 002x1S p ^0K/lh崬P R\H \0 ]\PU UE`x `0 t< ӫ "O- M PX\Q p\`Q1@ 003  0APSF ۻP0*\1 CR  P\V0A SЍS 00  VP,V 80 㰻P0LЍ EP\08 0ЍQ Q 08 00p\Ѝ臫 #0 SV/  1 0"Pd0X 0T P180 H!41002x1S 200- M00V Ѝ0-M0lMЍ//////////` p@-@Q  P0`00 3/PP 0 0UPpp 1 O-Q0[P0M[p< 0XaȰ`@0T1 @1@0081 00,1`0 0 1(0$0000 3/P 0 UC. 00[$    3P@0T0Ȱ@@@E00@W@ @WᴩЍ@G 00Ѝ<00DT$nXdTH0#@-R3S S CR x/o?o"20 0R /@-ɨo  PQPQ/@-"oA-pPPp) 000S @`@1S fP t t0 A003/0H@ 0003/$000,lH0@-`@`0@ 0R M Ѝ00S PP0<0 Ѝ0@/A-T@T0@0\0Sp`PP0 A@0/p@-T@T0@ 0R p0S `PzP0p@80/4A-h@h@ ^ \ p`P^P 04 A/HA-\@\0@0\ 0S p`P@P0 A00/P@-D@D0@ 0R 0S 'P0@0/\2A-@X!R Pd``  V^V?老 㔩0 Ꮹ`d`Ѝ p r0/ r03Ѝ p/ r0*Ѝ r0/SRQPM`-Ѝ /!1#0@-@P40y JZtPe@ 0!"# 0!6U0Ơ! p6#6 r04W @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rU*\0@D1?o 0 0C S  b 1 b0@T0@@T @@ d010 @d d001046#!@PE 40 010ʰ#0E208Q00 FV100/0@-K2@P0/0@-K2@Q`B a43!/23/0@-MQ /0@-P /0@-QZpK2@!˰\    ! 0bà01@O- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#p@-̌!J#Z 4 5o @`!:VV6 ŽP!`S<@D VL*P` T \^pa!@T Ptp@TX6tp@d @T @ @ Pd50!1p @d Pd40p Pd04511p4a@D 5/a 0PE 0/ 4#Z 5 ``!p`` 4f  5f!p>pp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{Q  aB Qp 00`BSoq /oo @ r S?C S?C S>C S>C S=C  S=C S>*SJ51:3////@-h1h2h3%10s %512s %u %10s %512s %u "%64[^"]" %u %u%s.%s.tmpw# Your alt-svc cache. https://curl.se/docs/alt-svc.html # This file was generated by libcurl! Edit at your own risk. %s %s %u %s %s %u "%d%02d%02d %02d:%02d:%02d" %u %d Excessive alt-svc header, ignoring.clearExcessive alt-svc host name, ignoring.Unknown alt-svc port number, ignoring.mapersistAdded alt-svc: %s:%d over %sUnknown alt-svc protocol "%s", skipping.ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_%c%c==%c%c%c=%ld%sConnection cache is full, closing the oldest oneunknown proxytype option givengetpeername() failed with errno %d: %sssrem inet_ntop() failed with errno %d: %sgetsockname() failed with errno %d: %sssloc inet_ntop() failed with errno %d: %ssa_addr inet_ntop() failed with errno %d: %s Trying %s:%d...Could not set TCP_NODELAY: %sFailed to set SO_KEEPALIVE on fd %dFailed to set TCP_KEEPIDLE on fd %dFailed to set TCP_KEEPINTVL on fd %dif!host!Couldn't bind to interface '%s'Local Interface %s is ip %s using address family %iName '%s' family %i resolved to '%s' family %iLocal port: %huBind to local port %hu failed, trying nextbind failed with errno %d: %sImmediate connect fail for %s: %sCouldn't bind to '%s'After %lldms connect time, move on!connect to %s port %u failed: %sConnection timeout after %ld msFailed to connect to %s port %u after %lld ms: %sConnection time-outError while processing content unencoding: %sError while processing content unencoding: Unknown failure within decompression software.1.2.0.41.2.11identityUnrecognized content encoding type. libcurl understands %s content encodings.chunkednonegzipx-gzipdeflate#HttpOnly_unknownFALSETRUE%s%s%s %s %s %s %lld %s %s%4095[^; =] =%4095[^; ]oversized cookie dropped, name/val %zu + %zu bytes__Secure-__Host-securehttponlydomainlocalhostskipped cookie with bad tailmatch domain: %sversionmax-ageexpires Added%s cookie %s="%s" for domain %s, path %s, expire %lldReplacedSet-Cookie:ignoring failed cookie_init for %s# Netscape HTTP Cookie File # https://curl.se/docs/http-cookies.html # This file was generated by libcurl! Edit at your own risk. %s WARNING: failed to save cookies in %s: %s ((((( AAAAAABBBBBB KGS!@#$%NTLMUSERLOGNAME\//usr/bin/ntlm_authCould not access ntlm_auth: %s errno %d: %sCould not open socket pair. errno %d: %sCould not fork. errno %d: %sCould not redirect child stdin. errno %d: %sCould not redirect child stdout. errno %d: %sntlmssp-client-1--helper-protocol--domain--username--use-cached-credsCould not execl(). errno %d: %sNTLMNTLM auth restartedNTLM handshake rejectedNTLM handshake failure (internal error)Proxy-YR %sAuthorization: NTLM %s TT %s LOGIN*EXTERNALXOAUTH2PLAINOAUTHBEARERDIGEST-MD5CRAM-MD5Unsupported SASL authentication mechanismGSSAPISCRAM-SHA-1SCRAM-SHA-256default/MATCH:/M:/FIND:lookup word is missingCLIENT libcurl 7.81.0 MATCH %s %s %s QUIT Failed sending DICT request/DEFINE:/D:/LOOKUP:CLIENT libcurl 7.81.0 DEFINE %s %s QUIT CLIENT libcurl 7.81.0 %s QUIT DICTa DoH request is completed, %u to goDoH request %sFailed to encode DoH packet [%d]Content-Type: application/dns-messagebad error codeAAAAUnexpected CLASSBad RCODEOut of memoryBad labelUnexpected TYPEOut of rangeRDATA lengthMalformatToo smallBad IDNo contentCould not DoH-resolve: %sDoH: %s type %s for %sDoH Host name: %sTTL: %u secondsDoH A: %u.%u.%u.%uDoH AAAA: %s%02x%02xCNAME: %sLabel loopName too long./..//.//../CONNECT_ONLY is required!Failed to get recent socketeasy handle already used in multi handleABSTRACT_UNIX_SOCKETACCEPTTIMEOUT_MSACCEPT_ENCODINGADDRESS_SCOPEALTSVCALTSVC_CTRLAPPENDAUTOREFERERAWS_SIGV4BUFFERSIZECAINFOCAINFO_BLOBCAPATHCERTINFOCHUNK_BGN_FUNCTIONCHUNK_DATACHUNK_END_FUNCTIONCLOSESOCKETDATACLOSESOCKETFUNCTIONCONNECTTIMEOUTCONNECTTIMEOUT_MSCONNECT_ONLYCONNECT_TOCONV_FROM_NETWORK_FUNCTIONCONV_FROM_UTF8_FUNCTIONCONV_TO_NETWORK_FUNCTIONCOOKIECOOKIEFILECOOKIEJARCOOKIELISTCOOKIESESSIONCOPYPOSTFIELDSCRLFCRLFILECURLUCUSTOMREQUESTDEBUGDATADEBUGFUNCTIONDEFAULT_PROTOCOLDIRLISTONLYDISALLOW_USERNAME_IN_URLDNS_CACHE_TIMEOUTDNS_INTERFACEDNS_LOCAL_IP4DNS_LOCAL_IP6DNS_SERVERSDNS_SHUFFLE_ADDRESSESDNS_USE_GLOBAL_CACHEDOH_SSL_VERIFYHOSTDOH_SSL_VERIFYPEERDOH_SSL_VERIFYSTATUSDOH_URLEGDSOCKETENCODINGERRORBUFFEREXPECT_100_TIMEOUT_MSFAILONERRORFILEFILETIMEFNMATCH_DATAFNMATCH_FUNCTIONFOLLOWLOCATIONFORBID_REUSEFRESH_CONNECTFTPAPPENDFTPLISTONLYFTPPORTFTPSSLAUTHFTP_ACCOUNTFTP_ALTERNATIVE_TO_USERFTP_CREATE_MISSING_DIRSFTP_FILEMETHODFTP_RESPONSE_TIMEOUTFTP_SKIP_PASV_IPFTP_SSLFTP_SSL_CCCFTP_USE_EPRTFTP_USE_EPSVFTP_USE_PRETGSSAPI_DELEGATIONHAPPY_EYEBALLS_TIMEOUT_MSHAPROXYPROTOCOLHEADERDATAHEADERFUNCTIONHEADEROPTHSTSHSTSREADDATAHSTSREADFUNCTIONHSTSWRITEDATAHSTSWRITEFUNCTIONHSTS_CTRLHTTP09_ALLOWEDHTTP200ALIASESHTTPAUTHHTTPGETHTTPHEADERHTTPPOSTHTTPPROXYTUNNELHTTP_CONTENT_DECODINGHTTP_TRANSFER_DECODINGHTTP_VERSIONIGNORE_CONTENT_LENGTHINFILEINFILESIZEINFILESIZE_LARGEINTERLEAVEDATAINTERLEAVEFUNCTIONIOCTLDATAIOCTLFUNCTIONIPRESOLVEISSUERCERTISSUERCERT_BLOBKEEP_SENDING_ON_ERRORKEYPASSWDKRB4LEVELKRBLEVELLOCALPORTLOCALPORTRANGELOGIN_OPTIONSLOW_SPEED_LIMITLOW_SPEED_TIMEMAIL_AUTHMAIL_FROMMAIL_RCPTMAIL_RCPT_ALLLOWFAILSMAXAGE_CONNMAXCONNECTSMAXFILESIZEMAXFILESIZE_LARGEMAXLIFETIME_CONNMAXREDIRSMAX_RECV_SPEED_LARGEMAX_SEND_SPEED_LARGEMIMEPOSTMIME_OPTIONSNETRCNETRC_FILENEW_DIRECTORY_PERMSNEW_FILE_PERMSNOBODYNOPROGRESSNOPROXYNOSIGNALOPENSOCKETDATAOPENSOCKETFUNCTIONPATH_AS_ISPINNEDPUBLICKEYPIPEWAITPORTPOST301POSTFIELDSIZEPOSTFIELDSIZE_LARGEPOSTQUOTEPOSTREDIRPREQUOTEPREREQDATAPREREQFUNCTIONPRE_PROXYPRIVATEPROGRESSDATAPROGRESSFUNCTIONPROTOCOLSPROXYAUTHPROXYHEADERPROXYPASSWORDPROXYPORTPROXYTYPEPROXYUSERNAMEPROXYUSERPWDPROXY_CAINFOPROXY_CAINFO_BLOBPROXY_CAPATHPROXY_CRLFILEPROXY_ISSUERCERTPROXY_ISSUERCERT_BLOBPROXY_KEYPASSWDPROXY_PINNEDPUBLICKEYPROXY_SERVICE_NAMEPROXY_SSLCERTPROXY_SSLCERTTYPEPROXY_SSLCERT_BLOBPROXY_SSLKEYPROXY_SSLKEYTYPEPROXY_SSLKEY_BLOBPROXY_SSLVERSIONPROXY_SSL_CIPHER_LISTPROXY_SSL_OPTIONSPROXY_SSL_VERIFYHOSTPROXY_SSL_VERIFYPEERPROXY_TLS13_CIPHERSPROXY_TLSAUTH_PASSWORDPROXY_TLSAUTH_TYPEPROXY_TLSAUTH_USERNAMEPROXY_TRANSFER_MODEPUTRANDOM_FILERANGEREDIR_PROTOCOLSREQUEST_TARGETRESOLVERESOLVER_START_DATARESOLVER_START_FUNCTIONRESUME_FROMRESUME_FROM_LARGERTSPHEADERRTSP_CLIENT_CSEQRTSP_REQUESTRTSP_SERVER_CSEQRTSP_SESSION_IDRTSP_STREAM_URIRTSP_TRANSPORTSASL_AUTHZIDSASL_IRSEEKDATASEEKFUNCTIONSERVER_RESPONSE_TIMEOUTSERVICE_NAMESHARESOCKOPTDATASOCKOPTFUNCTIONSOCKS5_AUTHSOCKS5_GSSAPI_NECSOCKS5_GSSAPI_SERVICESSH_AUTH_TYPESSSH_COMPRESSIONSSH_HOST_PUBLIC_KEY_MD5SSH_HOST_PUBLIC_KEY_SHA256SSH_KEYDATASSH_KEYFUNCTIONSSH_KNOWNHOSTSSSH_PRIVATE_KEYFILESSH_PUBLIC_KEYFILESSLCERTSSLCERTPASSWDSSLCERTTYPESSLCERT_BLOBSSLENGINESSLENGINE_DEFAULTSSLKEYSSLKEYPASSWDSSLKEYTYPESSLKEY_BLOBSSL_CIPHER_LISTSSL_CTX_DATASSL_CTX_FUNCTIONSSL_EC_CURVESSSL_ENABLE_ALPNSSL_ENABLE_NPNSSL_FALSESTARTSSL_OPTIONSSSL_SESSIONID_CACHESTDERRSTREAM_DEPENDSSTREAM_DEPENDS_ESTREAM_WEIGHTSUPPRESS_CONNECT_HEADERSTCP_FASTOPENTCP_KEEPALIVETCP_KEEPIDLETCP_KEEPINTVLTCP_NODELAYTELNETOPTIONSTFTP_BLKSIZETFTP_NO_OPTIONSTIMECONDITIONTIMEOUT_MSTIMEVALUE_LARGETLS13_CIPHERSTLSAUTH_PASSWORDTLSAUTH_TYPETLSAUTH_USERNAMETRAILERDATATRAILERFUNCTIONTRANSFERTEXTTRANSFER_ENCODINGUNIX_SOCKET_PATHUNRESTRICTED_AUTHUPKEEP_INTERVAL_MSUPLOADUPLOAD_BUFFERSIZEUSERAGENTUSERPWDUSE_SSLVERBOSEWILDCARDMATCHWRITEHEADERXFERINFODATAXFERINFOFUNCTIONXOAUTH2_BEARER%%%02XAccept-ranges: bytes Couldn't open file %sCan't open %s for writingCan't get the size of %sContent-Length: %lld Last-Modified: %s, %02d %s %4d %02d:%02d:%02d GMT %sCan't get the size of file.failed to resume file:// transferapplication/octet-streammultipart/form-dataEPSVPASVEPRTPORTSSLTLSAccept-ranges: bytes USER %sPBSZ %dQUITFailure sending QUIT command: %sMaximum file size exceededftp server doesn't support SIZEOffset (%lld) was beyond file size (%lld)File already completely downloadedInstructs server to resume from offset %lldREST %lldRETR %sConnect data stream passivelyAPPE %sSTOR %sSIZE %sCould not seek streamFailed to read dataFile already completely uploadedgetsockname() failed: %sfailed to resolve the address provided to PORT: %sbind(port=%hu) on non-local address failed: %sbind(port=%hu) failed: %ssocket failure: %s%s |%d|%s|%hu|Failure sending EPRT command: %s,%d,%dFailure sending PORT command: %sbind() failed, we ran out of ports!Error accept()ing server connectConnection accepted from serverDoing the SSL/TLS handshake on the data streamUploading to a URL without a file name!Request has same path as previous transfer;type=PASS %sACCT %sACCT requested but none availableAccess denied: %03dFailed EPSV attempt, exitingFailed EPSV attempt. Disabling EPSVPASV%c%c%c%u%cIllegal port number in EPSV replyWeirdly formatted EPSV reply%u,%u,%u,%u,%u,%uSkip %u.%u.%u.%u for data connection, re-use %s instead%u.%u.%u.%uBad PASV/EPSV response: %03dCan't resolve proxy host %s:%huCan't resolve new host %s:%huConnecting to %s (%s) port %dCouldn't interpret the 227-responseREST %dMDTM %sCWD %sLISTNLSTPRET %sPRET STOR %sPRET RETR %sCouldn't set desired modeGot a %03d response code instead of the assumed 200TYPE %cFTP response timeoutFTP response aborted due to select/poll error: %dWe got a 421 - timeout!Checking for server connectAccept timeout occurred while waiting server connectThere is negative response in cache while serv connectError while waiting for server connectReady to accept data connection from serverCtrl conn has data while waiting for data connPreparing for accepting server on data portGot a %03d ftp-server response when 220 was expectedunsupported parameter to CURLOPT_FTPSSLAUTH: %dAUTH %sACCT rejected by server: %03dPROT %cFailed to clear the command channel (CCC)SYSTEntry path is '%s'Failed to figure out pathOS/400SITE NAMEFMT 1QUOT command failed with %03dMKD %sServer denied you to change to the given directoryFailed to MKD dir: %03d%04d%02d%02d%02d%02d%02d%04d%02d%02d %02d:%02d:%02d GMTLast-Modified: %s, %02d %s %4d %02d:%02d:%02d GMT unsupported MDTM reply formatGiven file does not existThe requested document is not new enoughThe requested document is not old enoughSkipping time comparisonThe file does not existCouldn't use RESTPRET command not accepted: %03ddisabling EPRT usageFailed to do PORTConnect data stream activelyMaxdownload = %lldGetting file with size: %lldData conn was not available immediatelyRETR response: %03dFailed FTP upload: %0dWildcard - Parsing startedWildcard - START of "%s"Wildcard - "%s" skipped by userftp_perform ends with SECONDARY: %dRemembering we are in dir "%s"ABORFailure sending ABOR command: %scontrol connection looks deadpartial download completed, closing connectionExceeded storage allocationserver did not report OK, got %dUploaded unaligned file size (%lld out of %lld bytes)Received only partial file: %lld bytesNo data was received!QUOT string not accepted: %sFTPSFTP -> total rwx-tTsS0123456789-APM0123456789:

HEAD%s?%sFailed sending Gopher requestGOPHERSGOPHER6\xn--:%uHostname in DNS cache was stale, zappedShuffling %i addresses (non-permanent)%255[^:]:%dCouldn't parse CURLOPT_RESOLVE removal entry '%s'Resolve address '%s' found illegal!RESOLVE %s:%d is - old addresses discarded!Added %s:%d:%s to DNS cache%sRESOLVE %s:%d is wildcard, enabling wildcard checksCouldn't parse CURLOPT_RESOLVE entry '%s'!Hostname %s was found in DNS cache127.0.0.1::1hostCould not resolve %s: %s%256s "%64[^"]"unlimitedmax-age=includesubdomains# Your HSTS cache. https://curl.se/docs/hsts.html # This file was generated by libcurl! Edit at your own risk. %s%s "%d%02d%02d %02d:%02d:%02d" %s%s "%s" %d%02d%02d %02d:%02d:%02dRewind stream after sendNTLM send, close instead of sending %lld bytesEmpty reply from serverHTTP/3 requested for non-HTTPS URLHTTP/RTSP/If-Modified-SinceIf-Unmodified-SinceLast-ModifiedInvalid TIMEVALUE%s: %s, %02d %s %4d %02d:%02d:%02d GMT BasicBearerProxyServerDigestNTLM_WBProxy-authorizationAuthorization%s:%s%sAuthorization: Basic %s Authorization: Bearer %s %s auth using %s with user '%s'Forcing HTTP/1.1 for NTLMThe requested URL returned error: %dAuthentication problem. Ignoring this.Ignoring duplicate digest auth header.TCP6TCP4PROXY UNKNOWN PROXY %s %s %s %i %i Expect100-continueExpect:Expect: 100-continue Malformatted trailing header ! Skipping trailer.Host:Content-Type:Content-Length:Connection:Authorization:Transfer-Encoding:User-Agent[HostHost:%s Host: %s%s%s Host: %s%s%s:%d httpftp;type=%c?%sContent-TypeChunky upload is not supported by HTTP 1.0Transfer-Encoding: chunked Content-LengthFailed sending PUT requestContent-Length: 0 Failed sending POST requestContent-Type: application/x-www-form-urlencoded %x Failed sending HTTP POST requestFailed sending HTTP request; Cookie[::1]Cookie: %s%s=%sRange: bytes=%s Content-RangeContent-Range: bytes 0-%lld/%lld Content-Range: bytes %s%lld/%lld Content-Range: bytes %s/%lld Could only read %lld bytes from the inputIgnoring the response-bodyThe entire document is already downloadedHTTP server doesn't seem to support byte ranges. Cannot resume.Simulate a HTTP 304 response!, TEConnectionConnection: %s%sTE TE: gzip Accept: */* Proxy-Connection: Keep-Alive Accept-EncodingRefererReferer: %s Accept-Encoding: %s Accept%s Alt-UsedAlt-Used: %s:%d Proxy-Connection HTTP/%s %s%s%s%s%s%s%s%s%s%s%s%supload completely sent off: %lld out of %lld bytesOverflow Content-Length: value!Invalid Content-Length: valuekeep-aliveProxy-Connection:HTTP/1.0 proxy connection set to keep alive!closeHTTP/1.1 proxy connection set close!HTTP/1.0 connection set to keep alive!Content-Encoding:Retry-After:Content-Range:Last-Modified:WWW-Authenticate:Proxy-authenticate:Location:Strict-Transport-Security:Illegal STS header skippedAlt-Svc:HTTP 1.0, assume close after bodyReceived HTTP/0.9 when not allowedReceived 101no chunk, no close, no size. Assume close to signal endConnection closure while negotiating auth (HTTP 1.0?)Got 417 while waiting for a 100HTTP error before end of send, keep sendingHTTP error before end of send, stop sendingKeep sending data to get tossed away! HTTP/%1d.%1d%c%3d%c HTTP/%1[23] %dUnsupported response code in HTTP responseUnsupported HTTP version (%u.%d) in responseLying server, not serving HTTP/2Mark bundle as not supporting multiuse HTTP %3dUnsupported HTTP version in response RTSP/%1d.%1d%c%3dHTTPSHTTPOKToo long hexadecimal numberIllegal or missing hexadecimal sequenceMalformed encoding foundBad content-encoding found%.*s%sAuthorization: Digest %s %s cannot be done over CONNECTallocate connect buffer!CONNECT phase completed!Establish HTTP proxy tunnel to %s:%d%s%s%s:%dHost: %s CONNECT %s HTTP/%s %s%sUser-Agent: %s Failed sending CONNECT to proxyProxy CONNECT aborted due to timeoutProxy CONNECT connection closedProxy CONNECT abortedchunk reading DONECONNECT response too large!Ignore %lld bytes of response-bodyIgnore chunked response-bodyIgnoring Content-Length in CONNECT %03d responseIgnoring Transfer-Encoding in CONNECT %03d responseCONNECT responded chunkedHTTP/1.%d %dConnect me again pleaseReceived HTTP code %d from proxy after CONNECTProxy replied %d to CONNECT requestCONNECT%02xaws:amzfirst provider can't be emptysecond provider can't be emptyregion can't be emptyservice can't be emptyservice missing in parameters or hostnameregion missing in parameters or hostname%Y%m%dT%H%M%SZcontent-type:%s host:%s x-%s-date:%s content-type;host;x-%s-datehost;x-%s-date%s %s %s %s %s %s%s4_request%s/%s/%s/%s%s4-HMAC-SHA256 %s %s %s%s4%sAuthorization: %s4-HMAC-SHA256 Credential=%s/%s, SignedHeaders=%s, Signature=%s X-%s-Date: %s %%%u%c%03dLOGOUT(){ %*]LIST "%s" *Cannot SEARCH without a query string.SEARCH %sUID FETCH %s BODY[%s]<%s>UID FETCH %s BODY[%s]Cannot FETCH without a UID.PREAUTH* CAPABILITYSTORESELECTFETCHEXAMINESEARCHEXPUNGELSUBUIDGETQUOTAROOTNOOP+ Unexpected continuation responseAUTH=LOGIN %s %sAUTHENTICATE %s %sAUTHENTICATE %sNo known authentication mechanisms supported!PREAUTH connection, already authenticated!Got unexpected imap-server responseSTARTTLSLOGINDISABLEDSASL-IRSTARTTLS not available.STARTTLS deniedAuthentication cancelledAccess denied. %cOK [UIDVALIDITY %19[0123456789]]Mailbox UIDVALIDITY has changedSelect failedFound %lld bytes to downloadWritten %zu bytes, %llu bytes are left for transferFailed to parse FETCH response.UIDVALIDITYMAILINDEXSECTIONPARTIALCannot APPEND without a mailbox.Mime-VersionMime-Version: 1.0Cannot APPEND with unknown input file sizeAPPEND %s (\Seen) {%lld}Cannot SELECT without a mailbox.SELECT %simapIMAPSIMAPABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/0123456789ABCDEFrb-- --binaryCan't add itself as a subpart!.gifmultipart/mixed; name="; filename="; boundary=8bitform-dataattachmenttext/plainContent-Dispositionmultipart/Content-Disposition: %s%s%s%s%s%s%sContent-Type: %s%s%sContent-Transfer-EncodingContent-Transfer-Encoding: %s\\\"\""%22 %0D %0Aimage/gif.jpgimage/jpeg.jpeg.pngimage/png.svgimage/svg+xml.txt.htmtext/html.html.pdfapplication/pdf.xmlapplication/xml7bitbase64quoted-printable0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ(nil)(nil).%ldcurlNo MQTT topic found. Forgot to URL encode it?mqtt_doing: state [%d]Got DISCONNECTExpected %02x%02x but got %02x%02xRemaining length: %zd bytesEEEE AAAAGAINserver disconnectedState not handled yetUsing client id '%s'Error %d sending MQTT CONN requestClient ID length mismatched: [%lu]Username is too large: [%lu]Password is too large: [%lu]MQTTInternal error removing splay node = %dConnection #%ld to host %s left intactResolving timed out after %lld millisecondsConnection timed out after %lld millisecondsOperation timed out after %lld milliseconds with %lld out of %lld bytes receivedOperation timed out after %lld milliseconds with %lld bytes receivedInternal error clearing splay node = %dTransfer was pending, now try anotherHostname '%s' was found in DNS cacheoperation aborted by pre-request callback macdefmachineloginHOME%s%s.netrcGMTUTUTCWETBSTWAT<ASTADTEST,EDTCSThCDT,MSTMDThPSTPDTYSTYDTHSTXHDTCATXAHSTXNTIDLWCETMETMEWTMESTCESTMESZFWTFSTEETWAST\WADT CCT JSTEASTEADTlGSTNZT0NZST0NZDTIDLE0A<BxCDE,FhGHIKXLMNOPLQRST\U VWXlY0Z;Zx0NMonMondayJan%31[ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz]%02d:%02d:%02d%n%02d:%02d%nTuesdayWednesdayThursdayFridaySaturdaySundayFebMarAprMayJunJulAugSepOctNovDecTueWedThuFriSatSunserver response timeoutselect/poll errorcached response data too big to handleresponse reading failedExcessive server response line length received, %zd bytes. StrippingAUTH %s %sCAPA-ERR+OKAPOP %s %s+APOPRETR . Got unexpected pop3-server responseSTLSSASL STLS not supported.Authentication failed: %dpopPOP3SPOP3--:--:--%2lld:%02lld:%02lld%3lldd %02lldh%7lldd%5lld%4lldk%2lld.%0lldM%4lldM%2lld.%0lldG%4lldG%4lldT%4lldPCallback aborted** Resuming transfer from byte position %lld %% Total %% Received %% Xferd Average Speed Time Time Time Current Dload Upload Total Spent Left Speed %3lld %s %3lld %s %3lld %s %s %s %s %s %s %sWARNING: Using weak random seed0123456789abcdefCannot pause RTPFailed writing RTP dataGot an error writing an RTP packetThe CSeq of this request %ld did not match the response %ldGot an RTP Receive with a CSeq of %ldANNOUNCEAccept: application/sdp GET_PARAMETERSET_PARAMETERRECORDDESCRIBESETUPPLAYPAUSETEARDOWNGot invalid RTSP requestGot invalid RTSP request: RTSPREQ_LASTRefusing to issue an RTSP request [%s] without a session ID.TransportTransport: %s Refusing to issue an RTSP SETUP without a Transport: header.Range: %s CSeqCSeq cannot be set as a custom header.SessionSession ID cannot be set as a custom header.%s %s RTSP/1.0 CSeq: %ld Session: %s %s%s%s%s%s%s%s%sContent-Type: text/parameters Content-Type: application/sdp Failed sending RTSP requestCSeq:: %ldUnable to read the CSeq header: [%s]Session:Got RTSP Session ID Line [%s], but wanted ID [%s]Got a blank Session IDRTSP* < > { } { } Send failure: %sRecv failure: %sWrite callback asked for PAUSE when not supported!Failure writing output to destinationFailed writing header ALLFLUSHRELOAD NT LM 0.12SMB\\\?????Invalid input packetarm-himix200-linux-gnucurlSMBSSMBEHLO %sRCPT TO:<%s@%s>RCPT TO:<%s>@ SMTPUTF8HELPVRFY %s%s%s%sEXPN%s %s%sGot unexpected smtp-server response: %dHELO %sRemote access denied: %dSMTPUTF8AUTH STARTTLS not supported.Unexpectedly short EHLO responseSTARTTLS denied, code %dCommand failed: %dMAIL failed: %dRCPT failed: %d (last error)DATA failed: %dRCPT failed: %d AUTH= SIZE=<>MAIL FROM:%s%s%s%s%s%sFailed to alloc scratch buffer! ..smtpSMTPSSMTPunknownSOCKS4%s: connecting to HTTP proxy %s port %dSOCKS4 communication to %s:%dSOCKS4 non-blocking resolve of %sHostname '%s' was foundFailed to resolve "%s" for SOCKS4 connect.Too long SOCKS proxy user name, can't use!SOCKS4: too long host nameFailed to send SOCKS4 connect request.SOCKS4: Failed receiving connect request ack: %sconnection to proxy closedSOCKS4 reply has wrong version, version should be 0.SOCKS4%s request granted.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected or failed.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because SOCKS server cannot connect to identd on the client.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because the client program and identd report different user-ids.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), Unknown.SOCKS4 connect to IPv4 %s (locally resolved)SOCKS4 connection to %s not supportedSOCKS5: connecting to HTTP proxy %s port %dSOCKS5: server resolving disabled for hostnames of length > 255 [actual len=%zu]warning: unsupported value passed to CURLOPT_SOCKS5_AUTH: %luUnable to send initial SOCKS5 request.Unable to receive initial SOCKS5 response.Connection to proxy closedReceived invalid version in initial SOCKS5 response.SOCKS5 GSSAPI per-message authentication is not supported.No authentication method was acceptable.Undocumented SOCKS5 mode attempted to be used by server.Excessive user name length for proxy authExcessive password length for proxy authFailed to send SOCKS5 sub-negotiation request.Unable to receive SOCKS5 sub-negotiation response.User was rejected by the SOCKS5 server (%d %d).SOCKS5: hostname '%s' foundFailed to resolve "%s" for SOCKS5 connect.SOCKS5 connect to IPv4 %s (locally resolved)SOCKS5 connect to IPv6 %s (locally resolved)SOCKS5 connection to %s not supportedSOCKS5 connect to %s:%d (remotely resolved)Failed to send SOCKS5 connect request.Failed to receive SOCKS5 connect request ack.SOCKS5 reply has wrong version, version should be 5.Can't complete SOCKS5 connection to %s. (%d)SOCKS5 reply has wrong address type.SOCKS5 request granted.Operation too slow. Less than %ld bytes/sec transferred the last %ld secondsNo errorUnsupported protocolFailed initializationURL using bad/illegal format or missing URLA requested feature, protocol or option was not found built-in in this libcurl due to a build-time decision.Couldn't resolve proxy nameCouldn't resolve host nameCouldn't connect to serverWeird server replyAccess denied to remote resourceFTP: The server failed to connect to data portFTP: Accepting server connect has timed outFTP: The server did not accept the PRET command.FTP: unknown PASS replyFTP: unknown PASV replyFTP: unknown 227 response formatFTP: can't figure out the host in the PASV responseError in the HTTP2 framing layerFTP: couldn't set file typeTransferred a partial fileFTP: couldn't retrieve (RETR failed) the specified fileQuote command returned errorHTTP response code said errorFailed writing received data to disk/applicationUpload failed (at start/before it took off)Failed to open/read local data from file/applicationTimeout was reachedFTP: command PORT failedFTP: command REST failedRequested range was not delivered by the serverInternal problem setting up the POSTSSL connect errorCouldn't resume downloadCouldn't read a file:// fileLDAP: cannot bindLDAP: search failedA required function in the library was not foundOperation was aborted by an application callbackA libcurl function was given a bad argumentFailed binding local connection endNumber of redirects hit maximum amountAn unknown option was passed in to libcurlMalformed option provided in a setoptServer returned nothing (no headers, no data)SSL crypto engine not foundCan not set SSL crypto engine as defaultFailed to initialise SSL crypto engineFailed sending data to the peerFailure when receiving data from the peerProblem with the local SSL certificateCouldn't use specified SSL cipherSSL peer certificate or SSH remote key was not OKProblem with the SSL CA cert (path? access rights?)Unrecognized or bad HTTP Content or Transfer-EncodingInvalid LDAP URLRequested SSL level failedFailed to shut down the SSL connectionFailed to load CRL file (path? access rights?, format?)Issuer check against peer certificate failedSend failed since rewinding of the data stream failedLogin deniedTFTP: File Not FoundTFTP: Access ViolationDisk full or allocation exceededTFTP: Illegal operationTFTP: Unknown transfer IDRemote file already existsTFTP: No such userConversion failedCaller must register CURLOPT_CONV_ callback optionsRemote file not foundError in the SSH layerSocket not ready for send/recvRTSP CSeq mismatch or invalid CSeqRTSP session errorUnable to parse FTP file listChunk callback failedThe max connection limit is reachedSSL public key does not match pinned public keySSL server certificate status verification FAILEDStream error in the HTTP/2 framing layerAPI function called from within callbackAn authentication function returned an errorHTTP/3 errorQUIC connection errorproxy handshake errorSSL Client Certificate requiredUnknown errorPlease call curl_multi_perform() soonInvalid multi handleInvalid easy handleInternal errorInvalid socket argumentUnknown optionThe easy handle is already added to a multi handleWakeup is unavailable or failedUnknown share optionShare currently in useInvalid share handleFeature not enabled in this libraryCURLSHcode unknownAn invalid CURLU pointer was passed as argumentAn invalid 'part' argument was passed as argumentMalformed input to a URL functionPort number was not a decimal number between 0 and 65535This libcurl build doesn't support the given URL schemeURL decode error, most likely because of rubbish in the inputA memory function failedCredentials was passed in the URL when prohibitedAn unknown part ID was passed to a URL API functionNo scheme part in the URLNo user part in the URLNo password part in the URLNo options part in the URLNo host part in the URLNo port part in the URLNo query part in the URLNo fragment part in the URLNo zoneid part in the URLBad login partBad IPv6 addressBad hostnameBad file:// URLUnsupported number of slashesBad schemeBad pathBad fragmentBad queryBad passwordBad userCURLUcode unknownUnknown error %dUSER,%s%127[^= ]%*[ =]%255sXDISPLOCNEW_ENVWS%hu%*[xX]%huSyntax error in telnet option: %sBINARYUnknown telnet option %sRCVDSENT%s IAC SB (terminated by %u , not IAC SE!) (Empty suboption?)%s (unsupported)%d (unknown)Width: %d ; Height: %d IS SEND INFO/REPLY NAME "%s" = %.2x%c%c%c%c%s%c%cSending data failed (%d)%127[^,]%1[,]%127s%c%s%c%sEXOPLDONTDOWONTWILL%s IAC %s%s IAC %d%s %s %s%s %s %d%s %d %dIn SUBOPTION processing, RCVDTime-outTELNETEOFSUSPABORTEORSENOPDMARKBRKIPAOAYTECELGASBIACECHORCPSUPPRESS GO AHEADSTATUSTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIIBYTE MACRODE TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERM TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX3 PADNAWSTERM SPEEDLFLOWLINEMODEOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONset timeouts for state %d; Total % lld, retry %d maxtry %dReceived last DATA packet block %d again.Received unexpected DATA packet block %d, expecting block %dTimeout waiting for block %d ACK. Retries = %dtftp_rx: internal errorConnected for receiveReceived ACK for block %d, expecting %dtftp_tx: giving up waiting for block %d acktftp_tx: internal error, event: %iConnected for transmitbind() failed; %s;mode=octetnetasciiTFTP file name too long%s%c%s%ctsizeblksizeTFTP buffer too small for optionstftp_send_first: internal errorTFTP finishedInternal state machine errorReceived too short packetTFTP error: %sMalformed ACK packet, rejectinggot option=(%s) value=(%s)invalid blocksize value in OACK packetblksize is larger than max supportedblksize is smaller than min supportedserver requested blksize larger than allocated%s (%ld)blksize parsed from OACK%s (%d) %s (%d)requestedtsize parsed from OACKinvalid tsize -:%s:- value in OACK packetInternal error: Unexpected packetTFTPMoving trailers state machine from initialized to sending.operation aborted by trailing headers callbackSuccessfully compiled trailers.operation aborted by callbackRead callback asked for PAUSE when not supported!read function returned funny value%zx%sSignaling end of chunked upload after trailers.Signaling end of chunked upload via terminating chunk.Cannot rewind mime/post dataseek callback returned error %dthe ioctl callback returned %dioctl callback returned error %dnecessary data rewind wasn't possibleselect/poll returned errorExcess found: excess = %zd url = %s (zero-length body)Failed reading the chunked-encoded stream%s in chunked-encodingLeftovers after chunking: % lldu bytesExcess found in a read: excess = %zu, size = %lld, maxdownload = %lld, bytecount = %lldwe are done reading and this is set to close, stop sendWe are completely uploaded and fineDone waiting for 100-continuetransfer closed with %lld bytes remaining to readtransfer closed with outstanding read data remainingNo URL set!Maximum (%ld) redirects followedIssue another request to this URL: '%s'Switch from POST to GETSwitch to %sREFUSED_STREAM, retrying a fresh connectConnection died, tried %d times before giving upConnection died, retrying a fresh connect (retry count: %d)C%lld-Invalid zoneid: %s; %shttpssocks5hsocks5socks4asocks4socksUnsupported proxy scheme for '%s'Unsupported proxy syntax in '%s'Unsupported proxy '%s', libcurl is built without the HTTPS-proxy support.Too old connection (%ld seconds idle), disconnect itToo old connection (%ld seconds since creation), disconnect itConnection %ld seems to be dead!Connected to %s (%s) port %u (#%ld)Closing connection %ldcan multiplexseriallyFound bundle for host %s: %p [%s]Server doesn't support multiplex yet, waitServer doesn't support multiplex (yet)Could multiplex, but not asked to!Can not multiplex, even if we wanted to!Connection #%ld is still name resolving, can't reuseConnection #%ld isn't open enough, can't reuseMultiplexed connection found!Found pending candidate for reuse and CURLOPT_PIPEWAIT is setIDN support not present, can't parse Unicode domainsALL_PROXYall_proxyftp@example.comanonymousno_proxyNO_PROXY%s://%sSwitched from HTTP to HTTPS due to HSTS => %sProtocol "%s" not supported or disabled in libcurlmemory shortagehttp_proxyUses proxy env variable %s == '%s'Couldn't find host %s in the %s file; using defaults%25Please URL encode %% as %%25, see RFC 6874.Invalid IPv6 address formatNo valid port number in connect to host string (%s)Connecting to hostname: %sConnecting to port: %dAlt-svc connecting from [%s]%s:%d to [%s]%s:%dRe-using existing connection! (#%ld) with %s %sNo more connections allowed to host %s: %zuNo connections available in cacheNo connections available.NTLM picked AND auth done set, clear picked!NTLM-proxy picked AND auth done set, clear picked!Unix socket path too long: '%s'Failed to resolve host '%s' with timeout after %ld msCould not resolve host: %sCouldn't resolve proxy '%s' //%%%02x0123456789abcdefABCDEF:.25 dictldappop3localhost/127.0.0.1/[%*45[0123456789abcdefABCDEF:.]%c%n%*[^]]%c%nftp.dict.ldap.imap.smtp.pop3.#;file://%s%s%s%%25%s]%s://%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slibcurl/7.81.0zlib/%sc-ares/%sftpsgophergophersimapsmqttpop3srtspsmbsmbssmtpstelnettftp%s %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%s:%s:%sauth-int%s:%s:%08x:%s:%s:%susername="%s", realm="%s", nonce="%s", uri="%s", cnonce="%s", nc=%08x, qop=%s, response="%s"username="%s", realm="%s", nonce="%s", uri="%s", response="%s"%s, opaque="%s"%s, algorithm=%s%s, userhash=truenonce="realm="algorithm=qop=",auth-confusername="%s",realm="%s",nonce="%s",cnonce="%s",nc="%s",digest-uri="%s",response=%s,qop=%smd5-sess00000001AUTHENTICATEnoncestaletruerealmopaqueqopalgorithmMD5-sessSHA-256SHA-256-SESSSHA-512-256SHA-512-256-SESSuserhashNTLMSSPNTLM handshake failure (bad type-2 message)NTLM handshake failure (bad type-2 message). Target Info Offset Len is set incorrect by the peerNTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sgethostname() failed, continuing without!NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%cincoming NTLM message too biguser + domain + host name too bign,a=%s,host=%sauth=Bearer %sn,a=%s,host=%sport=%ldauth=Bearer %suser=%sauth=Bearer %s%s/%s@%s%s/%s%s@%s\/@SSLKEYLOGFILE0123456789ABCDEFSSL_ERROR_NONESSL_ERROR_SSLSSL_ERROR_WANT_READSSL_ERROR_WANT_WRITESSL_ERROR_WANT_X509_LOOKUPSSL_ERROR_SYSCALLSSL_ERROR_ZERO_RETURNSSL_ERROR_WANT_CONNECTSSL_ERROR_WANT_ACCEPTSSL_ERROR unknownold SSL session ID is stale, removingfailed to store ssl sessionTLSv1.1TLSv1.2TLSv1.0SSLv3SSLv2TLS UnknownTLS change cipherTLS alertChange cipher specClient helloErrorNext protocolCertificate StatusFinishedCERT verifyServer finishedRequest CERTClient key exchangeServer key exchangeCertificateNewsession TicketServer helloHello requestClient CERTServer verifyClient finishedClient keyINTLS handshakeTLS app dataTLS header(%x)%s (%s), %s, %s (%d): %s(%s)OpenSSL%s/%lx.%lx.%lx%sset default crypto engine '%s'set default crypto engine '%s' failedlibcurl is now using a weak random seed!PEMENGP12http/1.1NPN, negotiated HTTP1.1NPN, no overlap, use HTTP1.1OpenSSL SSL_write: %s, errno %dError: %s does not support double SSL tunneling.SSL_write() error: %sOpenSSL SSL_read on shutdown: %s, errno %dSSL shutdown timeoutselect/poll on SSL socket, errno: %dSSL_get_shutdown() returned SSL_SENT_SHUTDOWNSSL_get_shutdown() returned SSL_RECEIVED_SHUTDOWNSSL_get_shutdown() returned SSL_SENT_SHUTDOWN|SSL_RECEIVED__SHUTDOWNCLIENT_RANDOMSSL certificate problem: %sSSL certificate verification failedOpenSSL SSL_connect: %s in connection to %s:%ld SSL connection using %s / %sALPN, server accepted to use %.*sALPN, server did not agree to a protocolOpenSSL SSL_read: %s, errno %dSSL Engine '%s' not foundFailed to initialise SSL Engine '%s': %s(memory blob)ALL:!EXPORT:!EXPORT40:!EXPORT56:!aNULL:!LOW:!RC4:@STRENGTHNo SSLv2 supportNo SSLv3 supportUnrecognized parameter passed via CURLOPT_SSLVERSIONSSL: couldn't create a context: %sOpenSSL was built without TLS 1.3 supportALPN, offering %sError setting ALPNcould not load PEM client certificate, OpenSSL error %s, (no key found, wrong pass phrase, or wrong file format?)could not load ASN1 client certificate, OpenSSL error %s, (no key found, wrong pass phrase, or wrong file format?)pkcs11:LOAD_CERT_CTRLssl engine does not support loading certificatesssl engine cannot load client cert with id '%s' [%s]ssl engine didn't initialized the certificate properly.unable to set client certificatecrypto engine not set, can't load certificateBIO_new_mem_buf NULL, OpenSSL error %sBIO_new return NULL, OpenSSL error %scould not open PKCS12 file '%s'error reading PKCS12 file '%s'could not parse PKCS12 file, check password, OpenSSL error %scould not load PKCS12 client certificate, OpenSSL error %sunable to use private key from PKCS12 file '%s'private key from PKCS12 file '%s' does not match certificate in same filecannot add certificate to client CA listcannot add certificate to certificate chainnot supported file type '%s' for certificateunable to set private key file: '%s' type %scurl user interfaceunable do create OpenSSL user-interface methodfailed to load private key from crypto engineunable to set private keycrypto engine not set, can't load private keynot supported file type for private keyunable to create an SSL structurePrivate key does not match the certificate public keyfailed setting cipher list: %sCipher selection: %sUsing TLS-SRP username: %sUnable to set SRP user namefailed setting SRP passwordSetting cipher list SRPfailed setting SRP cipher listerror importing CA certificate bloberror importing CA certificate blob, continuing anywayerror setting certificate verify locations: CAfile: %s CApath: %s CAfile: %s CApath: %serror loading CRL file: %ssuccessfully loaded CRL file: CRLfile: %serror signaled by ssl ctx callbackSSL: couldn't create a context (handle)!WARNING: failed to configure server name indication (SNI) TLS extensionSSL: SSL_set_session failed: %sSSL re-using session IDSSL: SSL_set_fd failed: %spkcs11file type P12 for private key not supported subjectAltName: host "%s" matched cert's "%s" subjectAltName: host "%s" matched cert's IP address! subjectAltName does not match %sSSL: no alternative certificate subject name matches target host name '%s'vtls/openssl.cSSL: illegal cert name fieldSSL: unable to obtain common name from peer certificateSSL: certificate subject name '%s' does not match target host name '%s' common name: %s (matched)[NONE]SubjectIssuer%lxVersionSerial NumberSignature AlgorithmPublic Key AlgorithmStart dateExpire date Unable to load public keyRSA Public Keyrsadsaqpub_keySignature%02x:CertSSL: couldn't get peer certificate!%s certificate: subject: %s start date: %.*s expire date: %.*sSSL: couldn't get X509-issuer name! issuer: %sSSL: Unable to open issuer cert (%s)SSL: Unable to read issuer cert (%s)SSL: Certificate issuer check failed (%s) SSL certificate issuer check ok (%s)SSL certificate verify result: %s (%ld) SSL certificate verify result: %s (%ld), continuing anyway. SSL certificate verify ok.No OCSP response receivedInvalid OCSP responseInvalid OCSP response status: %s (%d)OCSP response verification failedError getting peer certificateError computing OCSP IDCould not find certificate ID in OCSP responseOCSP response has expiredSSL certificate status: %s (%d)SSL certificate revocation reason: %s (%d)SSL: public key does not match pinned public key!SSL connection timeoutopenssl(Unrecognized parameter value passed via CURLOPT_SSLVERSIONCURL_SSLVERSION_MAX incompatible with CURL_SSLVERSIONCURL_SSL_BACKEND%s:sha256// public key hash: sha256//%s;sha256//-----BEGIN PUBLIC KEY----- -----END PUBLIC KEY-----multiN  ܢL4LtL@$l@ @4 x  t@(   $,D @`\xTL@h,``cdXcccP$,܀@ԀԀܘPg$,܀@ԀԀܘPf%XP F %XF3\']&:d"'T"!3\']&:T"P @=DXHl+H=D`ж L( P=D`ж L(?@@??>t,?t@@lt@>@@$@0@$@8@@@L@T@d@L?l@t@@t@@@@@B)` @[dH8I(0 MOD @(T OOh +t  x' k P '' (' =   T ( '0 < uhN'P '` Nt ' N q ' g  *' O' O'   ' 0 @ 'L 'X 'd "|   G r u : D u u ( ; 3( '4 H X ,` +l 't c ' Nl'  '  lb/ ' < u 7'  m'$ I(0 XO@ (L w'T I'd XNx D ' o ' ' ; e ' ' ( v(((8(<iT(d(|'((e((f(,@Xp%( ( ( (6 ,'\''$ '4 ,NT '('!(00OHTuh''t'''1('Np('8t'@'LN\ h|' 'G('N''('<)'D*'Tf'`cpi'|Zg'*'h'd c'}'N:($4@Q@T5'\(l( yV'(!  8("D>vT$(d'x'',(;O5'i. n'4"''@'HwP)XH 'X +Nh-'tI'N'< 0QQLGCC: (HC&C V100R002C00B020_20180814) 6.3.0A/aeabi%ARM926EJ-S ,`$|e"H<n,pd@,LP h}h(& *&T$P&e"l?"&W?":$?"N?"bd?"vd{?"{?   f?L int>G;  B =h 7E@ N4= X, j   #   * , } f $ ( , u0 {4 ,8 ^ ,< (@ m\D jF 0G H ,!P )SX *S\ 0 +S` 7 ,Sd > .3h , /,l #1p A u ^u { ,D  =  'h , ;V < =D{{q{, , 6S6T,hhhnU "{W ${ # 1, 6, :,    ,t   ,v L , *>` /-3Bh 6Nt " B >x  L_M3 a \ K  %   !5b)=  ; L !"#$`%J& ' (<)*+E,y-' ._ / 0f1 23> 4)56"7 8E98: ;< ==>! ?@TA B CD,E#FGH IJKYLMbNkOPQRSTUVWUXCY:Z} [\O ] ^_`o aA bK cbde f" ghijk % H w - >ci> @: i@ v     F     E5, G P, Q,H R  Ty W, Y  Bc> N: 8> Udsp ] _  `rev a, T b: cd  dI o, > | &Q          y  1 , ,2 ,E , , , , , , , , ,9 ,U ,  ,  , , ,5 ,R , , , , , ,W , , , , d     $ > M wE     ' >q ,kuUq a~E@8 % |     3 L a   G ;G) 1  f?h"  Gint,;  B =h 7E@ N4= X3 j   #   * , } f $ ( , u0 {4 38 ^ 3< (@ m\D jF 0G H ,!P )SX *S\ 0 +S` 7 ,Sd > .:h , /3l #1p A u ^u { 3D  =  'h , ;V < =D{{q{3 3 6S6T3hhhnU "{W ${ # 13 63 :3    3t   3v L 3 *,` /-3Bh 6Nt " B ,x  L_M3 a \ K  %   !5b)=  ; L !"#$`%J& ' (<)*+E,y-' ._ / 0f1 23> 4)56"7 8E98: ;< ==>! ?@TA B CD,E#FGH IJKYLMbNkOPQRSTUVWUXCY:Z} [\O ] ^_`o aA bK cbde f" ghijk % H w - >ci, @: i@ v     F     E5, G P3 Q3H R  Ty W3 Y  Bc, N: 8, Udsp ] _  `rev a3 T b: cd  dI o3 , | &Q          y  1 3 32 3E 3 3 3 3 3 3 3 3 39 3U 3  3  3 3 35 3R 3 3 3 3 3 3W 3 3 3 3 d     $ , M wE     ' ,q 3kuUq X{, `x@8 % |      | ha| (hi Plo n u f?h(|=int>G;  B h 7E@ Nx46 X, j   #   * , } f $ ( , n0 t4 ,8 ^ ,< (@ m\D jF 0zG H ,!P )SX *S\ 0 +S` 7 ,Sd > .3h , /,l #1p A n ^n t ,=  6  'h , ;V < =Dttqt,   ,  6S6M,aaagU "tW $t # 1, 6, :,    ,t   ,v L , *>` /&,;a 6Gt  ; >x  L_M3 a \ K  %   !5b)=  ; L !"#$`%J& ' (<)*+E,y-' ._ / 0f1 23> 4)56"7 8E98: ;< ==>! ?@TA B CD,E#FGH IJKYLMbNkOPQRSTUVWUXCY:Z} [\O ] ^_`o aA bK cbde f" ghijk %  H  w -  >\i> @: i@ v     F     E., G P, Q,H R  Ty W, Y Bc> N3 8> U]sp ] _  `rev a, T b3 c ]  dI o, > |{ &Q          y  1 , ,2 ,E , , , , , , , , ,9 ,U ,  ,  , , ,5 ,R , , , , , ,W , , , , d     $ > F wE     ' >q ,kuUj X{>`%@8  u     h h( n d rp q r Xy  lz1z lz2z iz kz I "7{?"K?_(U%%%%%%%%% $ > $ > : ; I  I&I : ;  : ; I8 : ;I8 : ; I !I/ <4: ;I?<4: ; I?<!'II& I: ; ( ': ;I I: ; : ; : ;I8 .?: ;'I@B: ;IB11 .?<n: ; n% $ > $ > : ; I  I&I : ;  : ; I8 : ;I8 : ; I !I/ <4: ;I?<4: ; I?<!'II& I: ; ( ': ;I I: ; : ; : ;I8 .?: ;'I@B: ;I4: ;I% $ > $ > : ; I  I&I : ;  : ; I8 : ;I8 : ; I !I/ <4: ;I?<4: ; I?<!'II& I: ; ( ': ;I I: ; : ; : ;I8 .?: ;'I@B: ;I: ;I4: ;I 4: ;I%%U%h, ../sysdeps/armcrti.S`?/0////|e0 /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armbpabi.SZK///00g2///00g////2/00g//2/0/g// /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armbpabi.SL/g /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armieee754-df.S/365//00////2/0////////301////3/1///3/3/ .1///////////0//2/5//3///1///1//50////2/////.0//0/3///2////20/5/20//2////1/////2/////2//3/0///20/00/10//02//1///0//0//2/// .0//0//0/// .0/04//2/ .0/04//02/ .///0///00/14/// .004/ .004/3/1/ ./1/0/0/0////// /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armieee754-df.S/2/305//0/ .10/0//11202///6/////////01.//////53020 .20/0620//620//620//620/0 /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armieee754-df.S6//0///112//0///.//////401//////1////10/10///2////0//1//110//1////1/////////0/2////////0/2////////0/3/////0///0////0///2/0/10/2///10//////////0//22////2// .6//0///112//////////120/////1/////1/0//////0//////0//////0//0/////////2/////10/10/10////2//0//0///3/2/0/////////////////00/0//// /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armlib1funcs.Sd /00///0////00/00/10//0L/0/2/////// /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armlib1funcs.S  .//Y9 /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/obj/build-gcc-final/gcc/include/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/install/target/usr/include/bits/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/install/target/usr/include/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/../include../.././gcc/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/../gcc/config/armlibgcc2.cstddef.htypes.hlibio.hstdio.hsys_errlist.herrno.hunistd.hgetopt.htime.hhashtab.hinsn-constants.harm.harm-opts.hlibgcc2.h /IK-0/--V9 /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/obj/build-gcc-final/gcc/include/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/install/target/usr/include/bits/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/install/target/usr/include/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/../include../.././gcc/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/../gcc/config/armlibgcc2.cstddef.htypes.hlibio.hstdio.hsys_errlist.herrno.hunistd.hgetopt.htime.hhashtab.hinsn-constants.harm.harm-opts.hlibgcc2.h 2FNk?K 9 /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/obj/build-gcc-final/gcc/include/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/install/target/usr/include/bits/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/install/target/usr/include/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/../include../.././gcc/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/../gcc/config/armlibgcc2.cstddef.htypes.hlibio.hstdio.hsys_errlist.herrno.hunistd.hgetopt.htime.hhashtab.hinsn-constants.harm.harm-opts.hlibgcc2.hh t. .t.g J0/y.5h.J1-/I/1LEiLOe/-/KK0 /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armlib1funcs.S0/////0/1//0L/2f/////// /usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/armieee754-df.S ///////1////0/0///0/P, ../sysdeps/armcrtn.Se/7 | 0ZJ FB J FJ F FF L | D<TH | p H T p$ H J p( H L p@ X H $pTt F D F j |  LJ B\ VB `0 PH  BH  BH  BH  BH  BH | l B4 ` B | 0d  | PD | (xLBX B | hB | h(D |  | 4T j ../sysdeps/arm/crti.S/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/glibc-2.24/csuGNU AS 2.29/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/arm/bpabi.S/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/obj/build-gcc-final/arm-linux-gnueabi/libgcc/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/arm/ieee754-df.S/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/config/arm/lib1funcs.Sarm710tarm_arch_iwmmxt_shortbufARM_EQ_IO_lock_tarm600program_invocation_short_namestderrarm2_IO_buf_endarm6arm_fp_modelARM_PCS_AAPCS_IWMMXToptoptarm9BASE_ARCH_0BASE_ARCH_2BASE_ARCH_3BASE_ARCH_4BASE_ARCH_5BASE_ARCH_6BASE_ARCH_7cortexa15cortexa7fa606te_IO_write_endvfp_reg_typefmp626getdate_err_flagsarm610arm10e_cur_columnarm9ecortexa72cortexa53arm_ccfsm_statearm1022efa626unspec_stringscortexm0plussmallmultiply__clz_tabARM_VCarm_arch_xscalearm7tdmiscortexm0plusARM_VSARM_GEarm_tune_strongarmarm7complex floatARM_GTarm620regscortexa5cortexa8cortexa9__timezoneBASE_ARCH_7EMhashval_tBASE_ARCH_6KZarm740tarm_arch_arm_hwdiv_posarm_fpu_desccortexa73cortexa35stdoutall_fpus_IO_save_endopterrfa626tearm7dmistrongarm110BASE_ARCH_3M__fixdfdilong long unsigned intmpcorenovfparm9tdmiarm_cond_codeARM_PCS_AAPCS_IO_backup_baseARM_PCS_AAPCS_LOCALarm_fpu_feature_setcortexr4cortexr5cortexr7cortexr8arm_arch_iwmmxt2VFP_NONE_fileno__pad2GNU C11 6.3.0 -mtls-dialect=gnu -g -g -g -O2 -O2 -O2 -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fvisibility=hiddenarm1156t2fs_sys_nerrprefer_neon_for_64bitscortexr4fsize_t_vtable_offset_markerscortexa12unspecv_stringscortexa15cortexa73cortexa53cortexa17_IO_read_basearm_arch3marm940tstdinarm920BASE_ARCH_4T_nextarm_regs_in_sequencereturn_used_this_functionBASE_ARCH_5TE_IO_markerarm1176jzfs_chainarm_lang_output_object_attributes_hookarm720tBASE_ARCH_5Earm7500fe_IO_2_1_stderr_processor_typearm_pcs_modearm_arch4tstrongarm1100arm700arm_tune_wbufhtab_hash_IO_read_ptrarm_arch_namecortexa32arm_arch_notmarm_arch5eARM_LE__fixunsdfdiBASE_ARCH_6JBASE_ARCH_6KBASE_ARCH_6MARM_LSARM_LT_IO_write_basestrongarm1110BASE_ARCH_6Zarm926ejsarm710_IO_2_1_stdin_long long intarm_fpu_attr_IO_2_1_stdout__IO_save_basehtab_hash_pointerBASE_ARCH_5Tarm7500arm968esBASE_ARCH_7AARM_FP_MODEL_UNKNOWNARM_MIarm_arch6karm_arch6mBASE_ARCH_7R__popcount_tabarm920tarm720arm1136jshtab_eq__pad1arm946es__pad3__pad4__pad5ARM_PCS_AAPCS_VFParm_arch_no_volatile_cecortexa57BASE_ARCH_8Aarm700iARM_NEarm60featuresoptindARM_HIprogram_invocation_nameoptargARM_NVarm_arch4cortexm0smallmultiplyarm_arch6arm_arch7arm_arch8long doublecortexa57cortexa53arm_tune_xscalearm_arch5cortexa17cortexa7arm7di__quad_tmaking_const_tablethumb_call_via_labelarm1156t2s_IO_read_endDFtypeARM_PCS_APCSARM_PCS_ATPCSshort intcomplex doublearm922tarm_ccmpcorebase_architecturearm_arch_crcarm1176jzsarm_current_ccfa526cortexa72cortexa73__environarm966es_IO_FILE_plusARM_PLmarvell_pj4BASE_ARCH_6T2BASE_ARCH_5TEJarm_tune_cortex_a9ARM_ALBASE_ARCH_7Marm_target_labelarm_target_insnarm250_lockxgene1sizetypepool_vector_labelarm1026ejs_old_offset_IO_FILEarm1136jfs_dont_use_rtx_here_arm70exynosm1UQItypeVFP_REG_D16arm_tunearm_cpp_interworkunsigned chararm7d__tzname_sbufcortexm1smallmultiplyarm_arch_thumb_hwdiv_IO_write_ptrarm10tdmiARM_FP_MODEL_VFPhtab_eq_pointerarm7marm_pic_registerfa726teARM_CC__aeabi_d2ulzarm_ld_schedarm810ARM_CSVFP_REG_SINGLEarm7dm__off_tgenericv7aarm_base_archshort unsigned int_sys_errlistarm_arch7emarm7100arm_pcs_defaultVFP_REG_D32ARM_PCS_UNKNOWNep9312arm3arm_arch_thumb2cortexm0cortexm1arm8cortexm3cortexm4arm7tdmicortexm7_flags2/usr1/code/CODE_CCTD_V1R2C00/code/current/SDK_CPU_UNIFIED/build/script/arm-himix200-linux/arm_himix200_build_dir/src/gcc-6.3.0/libgcc/libgcc2.carm_none__daylightarm1020earm710cqdf24xx_unused2_IO_buf_basearm_arch8_1arm1020t__off64_tUSItypeUDItype__udivmoddi4GNU C11 6.3.0 -mtls-dialect=gnu -g -g -g -O2 -O2 -O2 -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hidden../sysdeps/arm/crtn.SPQL%PQh% #P#hT #%p,%%A,#h%t,%%A,PQ(%RS(% PQRS(PQ|TUTUTUTU(TUdRSdVWRSDpQ\VvVvVH\`|eeee 4%=A\AZ|ee v   ̡ ԡТԢآܢ0( N` Q` ^| N|eN aNeN Nv vD ^Hv N ^ ^(7 N  ^< ND Dx ^ NLv Lv@ v ^lw N|w |w ^Hx N $ ^ N 0x ^8 ND GDH \` ^ N ^ N ^ N ^ N ^$ NTx wTx  ^, N0 ^ N ^ N  ^D NH ^ N ^ N ^ N ^ N ^ ^| | ^44T^P^| آN  ^ NЁ Ё ^ ^0N   ^t (^ԢԢN ) ^Ȃ ^Т5Т^(TNԂ ]Ԃ ^ N m vtp ^؄ N  ^ N ^< NL ^ N ^̇ N ^ N ^$ N\ ^< N ^| ^ N    ^ N t ^ N  D ^L NP ^ N ^ N ^ N ^Ș N̘ ^ N ^( N@ ^ N ^` N ` ^ȟ N ^( N8 ^D NH ^X ^ A $A ^L .N\ ^ 7AN M  ]@ ^ N l t hP ` x ^ N ^ N ^ N ^ N ^ N ^\ N   ^( N, ,l ^ N ^T NX ^, N4 ^ N ^ N p ^ȵ N̵ \  ^ N . ^t N ^d Nh ^ 8N( K(( ^H NP UP$ ^l Nt ^t q   ^ N( ( D< ^x N  ^8 NL L ^ N   !d 1l| ^ N E$ [ @ ^< NL jLT ^ N ~0    , ^, NL L` ^ N ^0 N8 ^x ^ܢܢML$42A^  QN Z ^ N e  t@ T  th  ^ N h ^ N@ @ ^ N ^H N ^\ Nx ^ N ^p N ^( N, ^ N ^ ^ N ^D NL ^ N ^ N  ^` Nl ^ N ^ N ^ N ^ N  ^D NH ^l Np ^ N ^ N ^ N ^  ^t ^t N NP N "N 5CN@ RcN t ^h  Nl  ^H  N\  ^t  N  ^ N ^@ ^  ^` NH H ^P NX X ^ N8 8 ^ N$ ^| N ^ N0 ^ NL N  ^ N  ^x N ^d Nt ^  N  ^p% N% ^(* ^d9d^` CO^N0* e0* ^<+ NH+ H+ ^, N$, s$, ^P0 ^^ {N0 0p 41 ^1 N1 1( 1 ^8 N8 ^X: Nl: ^G ^DD8^ NpH ^K ^p NK K4 ^M NM ^lM NtM N,N ,NP $_|N ^@O NdO dO` Ox ^4P N NP> ^p? N? ^C NC ^D ND ^D NE ^LG NG ^I NI ^tL NL ^T NHU ^W N,X ^Y NY ^[ N[ ^\ N\ ^] N] ^e NXf ^n Nlo ^p Np ^Tq NXq ^{ ^ ^' KNP| SN`| ^0 N4 ^ ^, aǸ ^T NX ^` N ^) oN ^Ć N ^ ^3 N  ^ N ^ N ^Њ N؊ ^D N ^ ^d4 Np ^X N\ ^ا ^9 N T ^, N4 4 ^ N( ( ^  N     ^h Nx x ^P Nl 0l ^@ NH AH ^\ N` Z` ^H NX dX8 ^ N T ^ܰ N < ^ N     ^ Nж ж  ^ l  Nܸ ܸ ^ N  ^0 ND DL ^ N 0 ^h Nl ^ ND LD  ^  NL TLl ^_$^ 9 htN  N4 N ^H NT ^ ^N    l ^l Nt th   ! /|8 ^ N = Npx c ^h Nt stx | hP ^ N H   ^ N     <| ^ N X X h ^ N + 9 ^ N ^x N ^x N ^ N Rx ^ N ^ N ^L NX ^ N ^$ N8 ^@ NX ^ N ^D NL ^ N ^ N ^\ Nd ^ N ^ N ^X= X=A e= l= ^pup HԧP^` N 4    ,\ @  ^0 N` ^ N ^h Nl ^ N0 ^ N ^ N ^@ NH ^ N ^ N ^ ^@ @% A% ,A 4A ^` #N *D ^8 N@ :@ GP Qp ^\  N`  `` `  ^) N) k) ^,. ^DA ^$^XA sN`. {`. x. . .  ^. N. . . .P 4/, `/T / ^41 N@1 @1 ^@6 NX6 X6D 6 ^,7 N07 <07` R7 jh8 ^: N; ^; N; ^< N< ^= N= ^= N= ^|> N> ^PA NlA ^A NA A ^F NF ^8G N ^ ! ^$ N<> ^D? N\? ^? ^88,dP^pQdLT^L^( N? N`@ `@ ^@ N@ ^A NA ^XB NdB (NB ^C ^ fNC /CD ^8D N!y0 I!y ^{ N{ Z!{ d! | ^| N| q!|X }!(}p !} ^~ N~ !~ ^  N$ !$h ^ N ! ^h Nx !xT ^ Ñ !̃ ^ N "| ^` Nd "d ^ N$ "$X ^ N ^ NH ."Hl ^ N 9" ^4 ND M"D f"`$ ^ s" """^^ """"#N #p ^4 N< #< ^ N '#d ^l Nt 7#tX ?#4 G# ^ N ]#t ^d Nl t#lh ^ N #h ^4 N< #<| ^ N #p ^  N( #(X ^x N # ^ N #t ^ N ^ N ^ N ^ N ^$ N, ^d Nl ^8 N< ^ N ^ N ^x N ^ N ^D NH ^ N ^T NX ^ N ^ N ^ N  ^  N$ ^ N ^ N ^ N ^ N ^D NL ^, N< ^ N ^ N@ ^T NX ^l Np ^ N ^ ^$$$$7$^@$ ^S$h^pR b$l$u$~$$$$$N ^$N ^T$N ^$N ^,$N ^$Nd %l %^@%^`N )%N ^)%N ^` ^)%Nh ^̡ ^3%N >% %^$V%N ^D^ԡh%ԡ^آv%آ%+ % % %H`% %$ %p %H &ЦP& .& ?&J\ Y& w&@ &$P& &X &@@ &\P&le & 'D ' )'P;'l F' Y' g'\ r'\( ' 'h '@ 'J< ' 'Bd (g@ "(Xl +(DT ?(` N(T a(tP z(lo( (d  (Ȇ@ (ܨP(x (|Z ( )̤P) 8)0L \) l) )_8 ) )I )(L )() $ ) *,@ !*T F*E U* o*H( |*, *H *mH *tM  *$a * *r *@S "+P4+d H+| X+X j+ t+H + ( +> +P +l +(]$ +t, ,lP,P-,D  @,x  P,X, c,y t,@ ,Hh ,0\ ,4M@ ,L ,l /,x ,( -@ -$` +-(2-h B-d Z-0 y-P -c -pHx -t  -D - -R .4 . ,. 5.8 >.\( P.X b.8m.4 x .̘  .؊$  . .H@ . .b .,X .H / < /'/Tf B/p8 S/ b/4o/Xq  / /, / /$ /t / /x< / / 04 &0( 90fL E0$4 T0@ a0fh r0  0( 0Lc< 0 0Ķ 0h` 00 0` 1$p 1x< .1zP >1( K1P \1N i1 z1C 1 @ 14d 11 1X 1X 1T4 1   2| 2@ 12 92T N2f@ _2P9 q2 2̱ 2]x 2( 2L 2K  2 2 2[P 2, 3dl #3l 13 B3D T3Pf3T t3<3 3L 3 3$N 3 3  3 4$ 40 -4\@ :4( F4X [4x o4@ }4T0 4T 4`| 4Є 48X 4 4H 5`;P 5h (5 65X  L5 h5H x5<L 5 5 5\P5 5\ 5 5 6P )6d > .>ll I>L b>L u>?  >ī` >0 >( > >\ , > ? ?L* +?` 4?D G? V?^?T q?M ?\ ? ? ?X ?̀ ? ?XP? @ @Y )@| 8@(D@ [@X s@ {@> @( @| @t @, @`p @T AP>L A| 0A GA XA@eA  xA< A\ APAPA x A  A`0 A<@ Bl: B4L "B|  /B CB KBX pByBD B@ BD B B BLP B`p B0@  Cs C\Hh *C 4C<@ AC, MCAL lCM< zCT CL C| CD CTt Ch( C,@ CP@  CxL D2 (DXf  9D LDp [D< mD̵X |D?\ DPD p Dd0 D|  D Dt E $El AEME\h _E sE@0 EtES E  E% E PE$ FD F( 3F IF| YFD jF yF| Fd$ Fh@, F@< FPPF@ FG$ GM G: .G, ?G& NGDp fG` }Gh GL GGdB, G R  G GM( G G HC "H ?H QH  aH` vH PH  H H  H(HH8 H@ HB I< 9Id FI ;@ ^I fI( xI I\ I$ I| I  I@ IKh IX| JD J  %JP 0JL KJ( _JhpJ Jpp J4 Je J| JX J J^ J K K +K$ 9K( LK8  fK  |K KD@ K^ K  {LH LHU LL L L|| L4 MhL Mh` &MtZ BM  PMl  jM@\ wM` M M ^% Ne ^e Ne MMMMNN%N;NINZN<^d kNwNNb  NNNNNh NNO OH@ O'O9O"SOeO;L vO}O OOOP8 OOOTS0 PP(P;PQPWYPkPPPPPPPP00 PP\Q QQ0Q@QNQWQkQ\? }QQQ@b QQQQQRR0RJRmR|RR RRRDZR y RR SS*ScOc<>  \cccvcb cclT cccccc dd1d EdQ< XdndX ddlA d$*< dddd@ d ee1eHeZeme~eeeeeee ff,f5fql Kf` [fqp tfl f@ f`< ffffgg )g;g Ugn$ ig~gggggR` ghZ hh\D 4h?hPhhh}hhhhhh`* hh iai#i2iBiUi< giziiiiii\  /opt/hisi-linux/x86-arm/arm-himix200-linux/host_bin/../target/usr/lib/crti.o$acall_weak_fn$d/opt/hisi-linux/x86-arm/arm-himix200-linux/host_bin/../target/usr/lib/crtn.ohttp_aws_sigv4.csha256_to_hex.constprop.0url.cup_freeconn_freestrip_trailing_dotsetup_rangezonefrom_url.isra.1parse_proxyextract_if_dead.part.4call_extract_if_deadCurl_verboseconnect.part.7ConnectionExistsCSWTCH.171protocolsCurl_handler_dummycrtstuff.c__JCR_LIST__deregister_tm_clones__do_global_dtors_auxcompleted.9275__do_global_dtors_aux_fini_array_entryframe_dummy__frame_dummy_init_array_entryaltsvc.caltsvc_createidgetalnumalpn2alpnidaltsvc_addamigaos.casyn-ares.csock_state_cbquery_completed_cbdestroy_async_data.isra.1waitperform.isra.2asyn-thread.cbase64.cbase64_encode.isra.0base64base64urlbufref.cc-hyper.cconncache.cconn_llist_dtorbundle_destroyfree_bundle_hash_entrybundle_remove_connconncache_find_first_connectionsigpipe_ignore.part.0hashkey.constprop.3connect.cconn_is_connconnect_SOCKSverifyconnectpost_SOCKSsingleipconnecttrynextipcontent_encoding.czalloc_cbzfree_cbclient_init_writererror_init_writererror_close_writernew_unencoding_writercheck_gzip_header.part.0process_zlib_error.isra.1gzip_init_writerexit_zlibgzip_close_writerdeflate_close_writerprocess_trailerdeflate_init_writerclient_unencode_writeinflate_streamgzip_unencode_writedeflate_unencode_writeidentity_close_writerclient_close_writeridentity_init_writeridentity_unencode_writeerror_unencode_writeidentity_encodingdeflate_encodinggzip_encodingerror_encodingclient_encodingcookie.cfreecookiecookie_sort_ctremove_expiredcookie_sorttailmatchsanitize_cookie_pathget_netscape_formatcookiehashcurl_addrinfo.ccurl_ctype.ccurl_des.ccurl_endian.ccurl_fnmatch.ccurl_get_line.ccurl_gethostname.ccurl_gssapi.ccurl_memrchr.ccurl_multibyte.ccurl_ntlm_core.csetup_des_keymagic.23174curl_ntlm_wb.cntlm_wb_cleanupntlm_wb_init.isra.0ntlm_wb_response.isra.1curl_path.ccurl_range.ccurl_rtmp.ccurl_sasl.cbuild_message.isra.1get_server_message.isra.3mechtablecurl_sspi.ccurl_threads.cdict.cunescape_worddict_dodoh.cskipqnamedoh_donedoh_write_cbdohprobeerrorsdotdot.cdynbuf.cdyn_nappendeasy.cconn_upkeepsigpipe_ignore.part.1easy_connectioninitializedeasygetopt.ceasyoptions.cescape.cfile.cfile_setup_connectionfile_donefile_disconnectfile_connectfile_dofileinfo.cformdata.csetnamefreedirsftp_state_userftp_state_loggedinftp_endofrespftp_statemachineftp_state_retrftp_state_use_pasvftp_state_ul_setupftp_state_use_portftp_timeleft_acceptAcceptServerConnectInitiateTransferwc_data_dtorftp_parse_url_pathftp_state_user_resp.isra.2ftp_domore_getsockftp_epsv_disableftp_state_pasv_respftp_state_restftp_state_prepare_transferftp_state_sizeftp_state_typeftp_nb_typeftp_state_mdtmftp_state_quoteftp_state_type_respReceivedServerConnectAllowServerConnectftp_do_moreftp_dophase_donemode.21847mode.21787ftpauth.22107ftplistparser.cftp_pl_insert_finfogetenv.cgetinfo.cgopher.cgopher_connectgopher_dogopher_connectinghash.chash_element_dtorhmac.chmac_ipadhmac_opadhostasyn.chostcheck.chostip.chostcache_timestamp_removefreednsentry.part.0freednsentryCurl_ipv6works.part.1create_hostcache_id.constprop.2hostip4.chostip6.chostsyn.chsts.chsts_createhsts_addhsts_pullhttp.cpickoneauthhttp_should_failhttp_getsock_dohttps_connectingreadmoredatahttp_perhapsrewindcheckprefixmaxhttps_getsockhttp_setup_conncheckhttpprefix.isra.4checkprotoprefix.isra.5Curl_add_timecondition.part.10output_auth_headersexpect100.isra.7http2.chttp_chunks.chttp_digest.chttp_negotiate.chttp_ntlm.chttp_proxy.cconnect_initidn_win32.cif2ip.cimap.cimap_setup_connectionimap_sendfimap_disconnectimap_getsockimap_multi_statemachimap_atomimap_perform_listimap_get_messageimap_cancel_authenticateimap_doneimap_continue_authenticateimap_perform_searchimap_perform_fetchimap_matchrespimap_endofrespimap_connectimap_statemachineimap_perform_upgrade_tlsimap_perform_login.part.8imap_perform_authenticateimap_perform_authenticationimap_doimap_doingsaslimapinet_ntop.cinet_pton.ckrb5.cllist.cCurl_llist_remove.part.0md4.cmd5.cmemdebug.cmime.cencoder_nop_sizeencoder_7bit_readencoder_base64_readencoder_base64_sizeencoder_qp_sizemime_mem_seekmime_mem_freemime_part_rewindmime_subparts_unbindencoder_qp_readencoder_nop_readmime_mem_readmime_file_freecontent_type_matchescape_stringmime_subparts_seekreadback_bytes.isra.1mime_file_readmatch_header.isra.6search_headermime_file_seekreadback_partread_part_content.part.7mime_subparts_freeaschexqp_classformtable.11292mimetable.11291encodersctts.11750mprintf.cstorebufferdprintf_DollarStringalloc_addbyterdprintf_formatflower_digitsupper_digitsnull.8546strnil.8560mqtt.cmqtt_setup_connmqtt_getsockmqtt_sendmqtt_get_topicmqtt_doingmqtt_domulti.ctrhashtrhash_comparetrhash_dtorsh_freeentryfd_key_comparehash_fdsockhash_destroybefore_performmulti_deltimeoutmulti_getsocksinglesocketclose_connect_onlymulti_timeout.isra.2.part.3sigpipe_ignore.part.4add_next_timeout.isra.6Curl_update_timer.part.10multi_wait.part.9process_pending_handlesmulti_donemulti_handle_timeoutinit_completedmulti_runsingletv_zero.22349netrc.cnon-ascii.cnonblock.copenldap.cparsedate.cparsedate.constprop.0tzmonth_days_cumulative.8353weekdaypingpong.cpop3.cpop3_setup_connectionpop3_cancel_authpop3_disconnectpop3_getsockpop3_multi_statemachpop3_doingpop3_donepop3_get_messagepop3_continue_authpop3_perform_authpop3_perform_upgrade_tlspop3_endofresppop3_perform_apop.part.10pop3_connectpop3_statemachinepop3_dopop3_perform_authenticationsaslpop3progress.ctime2strmax5datapsl.crand.cseeded.21085randseed.21084rename.crtsp.crtsp_getsock_dortsp_setup_connectionrtsp_disconnectrtsp_rtp_readwritertsp_connectrtsp_donertsp_dortsp_conncheckselect.csendf.cpausewrites_infotype.21574setopt.csetstropt_userpwdCSWTCH.40sha256.cmy_sha256_initmy_sha256_updatemy_sha256_finalshare.cslist.csmb.csmb_donesmb_disconnectsmb_getsocksmb_dosmb_sendsmb_send_and_recvsmb_connectsmb_setup_connectionsmb_send_messagesmb_send_tree_connectsmb_send_opensmb_request_statesmb_send_setupsmb_connection_statesmtp.csmtp_setup_connectionsmtp_cancel_authsmtp_perform_ehlosmtp_disconnectsmtp_getsocksmtp_multi_statemachsmtp_perform_upgrade_tlssmtp_get_messagesmtp_continue_authsmtp_perform_authsmtp_perform_authenticationsmtp_parse_url_pathsmtp_donesmtp_endofrespsmtp_connectsmtp_statemachinesmtp_parse_address.constprop.17smtp_perform_rcpt_tosmtp_perform_commandsmtp_dosmtp_doingsaslsmtpsocketpair.csocks.clookup.11473socks_gssapi.csocks_sspi.cspeedcheck.csplay.cKEY_NOTUSED.8292tv_zero.8298strcase.cstrdup.cstrerror.cstrtok.cstrtoofft.csystem_win32.ctelnet.ctelnet_donecheck_telnet_optionssend_telnet_dataprintsub.part.1sendsuboptionprintoptionsend_negotiationtelnet_dotelnetoptionstelnetcmdstftp.ctftp_translate_codetftp_disconnecttftp_getsocktftp_set_timeoutstftp_rxtftp_connect_for_rxtftp_txtftp_connect_for_txtftp_connecttftp_donetftp_setup_connectiontftp_option_add.isra.1tftp_send_firsttftp_state_machinetftp_multi_statemachtftp_dotftp_doingtimeval.ctransfer.ctrailers_readCurl_get_upload_buffer.part.1urlapi.cfree_urlhandlemv_urlhandlefind_host_sepjunkscanurlchar_needs_escapingstrcpy_urlhostname_check.isra.1parseurl.part.2seturlbadbytes.11307version.cout.21697ssl_buffer.21715version_win32.cwarnless.cwildcard.cfileinfo_dtorx509asn1.ccleartext.ccram.cauth_digest_sha256_to_asciiauth_digest_md5_to_asciiauth_digest_get_key_valuedigest_sspi.cgsasl.ckrb5_gssapi.ckrb5_sspi.ctype2_marker.23888ntlm_sspi.coauth2.cspnego_gssapi.cspnego_sspi.cvauth.cbearssl.cgskit.cgtls.ckeylog.ckeylog_file_fpmbedtls.cmbedtls_threadlock.cmesalink.cnss.copenssl.cSSL_ERROR_to_strossl_cert_status_requestossl_get_internalsossl_get_ssl_data_indexossl_get_ssl_conn_indexossl_get_ssl_sockindex_indexossl_get_proxy_indexossl_disassociate_connectionossl_associate_connectionossl_sha256sumossl_engines_listossl_session_freeossl_close_allossl_new_session_cbossl_tracessl_ui_writerssl_ui_readerpubkey_showossl_data_pendingossl_check_cxnossl_versionossl_cleanuppasswd_callbackossl_set_engine_defaultossl_closeone.isra.4ossl_closeossl_seed.part.5ossl_seeddo_file_typeossl_randomossl_initselect_next_proto_cbx509_name_oneline.constprop.16ossl_strerror.constprop.17ossl_sendossl_shutdownossl_connect_step2ossl_recvossl_set_engineossl_connect_step1servercertossl_connect_commonossl_connect_nonblockingossl_connectssl_ex_data_data_index.25732ssl_ex_data_conn_index.25736sockindex_index.25740proxy_index.25744rustls.cschannel.cschannel_verify.csectransp.cvtls.cblobdupmultissl_versionssl_prefs_checkblobcmpsafecmpmultissl_setup.part.2multissl_get_internalsmultissl_closemultissl_getsockmultissl_connect_nonblockingmultissl_connectmultissl_initssl_connect_init_proxyCurl_ssl_free_certinfo.part.11backends.21737selected.21736backends_len.21738init_sslavailable_backendsCurl_ssl_multiwolfssl.cngtcp2.cquiche.cvquic.clibssh.clibssh2.cwolfssh.c_aeabi_ldivmod.o_aeabi_uldivmod.o_arm_addsubdf3.o_arm_cmpdf2.o_arm_muldivdf3.o_divsi3.o.divsi3_skip_div0_testshift_dvmd_lnx.olibgcc2.c_udivsi3.o.udivsi3_skip_div0_test_arm_fixunsdfsi.o__FRAME_END____JCR_END__Curl_connectCurl_is_absolute_urlCurl_bufref_ptrCurl_easyoptsCurl_none_check_cxnCurl_mime_sizeCurl_readCurl_altsvc_loadCurl_handler_imapsCurl_conncache_remove_conn__aeabi_uldivmodCurl_auth_digest_get_pairCurl_conncache_extract_bundleCurl_read16_beCurl_handler_mqttCurl_output_ntlm_wbCurl_ssl_getsessionidCurl_set_dns_serversCurl_handler_httpCurl_tls_keylog_open__aeabi_dcmpleCurl_ip2addrCurl_ipv6worksCurl_handler_tftpCurl_failfCurl_none_shutdown__aeabi_uidivCurl_if2ipCurl_ftp_parselist_data_allocCurl_altsvc_saveCurl_ssl_addsessionidcurlx_uztoulCurl_SOCKS_getsockCurl_retry_requestCurl_auth_create_cram_md5_messageCurl_tls_keylog_writeCurl_nowCurl_http_useragentCurl_urldecodeCurl_host_is_ipnumCurl_idnconvert_hostnameCurl_http_statuslineCurl_pp_getsockCurl_pp_initCurl_handler_pop3sCurl_addr2stringCurl_auth_decode_ntlm_type2_messageCurl_mime_duppartCurl_handler_ftpsCurl_free_idnconverted_hostnameCurl_auth_create_digest_md5_message__aeabi_ldivmodCurl_hash_clean_with_criteriumCurl_splay__cmpdf2Curl_http_bodyCurl_auth_is_digest_supported__bss_start__Curl_sasl_can_authenticateCurl_conncache_return_connCurl_ssl_cleanupCurl_auth_decode_digest_http_messageCurl_http_hostCurl_mime_prepare_headersCurl_isprintCurl_resolver_cancelCurl_ssl_close_allCurl_fileinfo_cleanupCurl_dyn_resetCurl_splayinsertCurl_pin_peer_pubkeyCurl_strerrorCurl_auth_create_digest_http_messageCurl_handler_smtpCurl_strcasecompare__aeabi_cdcmpleCurl_mime_unpauseCurl_openCurl_share_lockCurl_uc_to_curlcodeCurl_multi_closedCurl_closeCurl_set_dns_local_ip6Curl_auth_create_ntlm_type3_messageCurl_set_in_callbackCurl_handler_gophersCurl_handler_smtpsCurl_loadhostpairsCurl_hash_cleanCurl_output_digestCurl_getformdata__aeabi_f2dCurl_free_request_stateCurl_auth_create_ntlm_type1_messageCurl_dyn_freeCurl_socket_checkCurl_set_dns_local_ip4Curl_writeCurl_isdigitCurl_pp_vsendfCurl_timediff_us_edataCurl_fetch_addrCurl_ssl_associate_connCurl_http_auth_cleanup_ntlm_wbCurl_slist_duplicateCurl_raw_toupperCurl_dedotdotifyCurl_multi_max_total_connectionsCurl_hsts_parseCurl_unix2addrCurl_expire_doneCurl_chunked_strerrorCurl_none_set_engine__adddf3Curl_dohCurl_altsvc_parseCurl_ssl_shutdownCurl_cfreeCurl_ntlm_core_lm_respCurl_resolver_wait_resolvCurl_proxyCONNECT_finicurlx_sztosiCurl_resolv_getsockCurl_splayremoveCurl_http_rangeCurl_base64url_encodeCurl_isgraph__bss_end__Curl_tls_keylog_write_lineCurl_bufref_freeCurl_read16_leCurl_cmallocCurl_http_readwrite_headers__eqdf2Curl_llist_count__aeabi_dsubCurl_hash_initCurl_hash_addCurl_infofCurl_hsts_loadfileCurl_ssl_versionCurl_altsvc_lookupCurl_resolver_getsockCurl_mime_initpartCurl_memdupCurl_ssl_closecurlx_uztosiCurl_saferealloc__aeabi_idivmodCurl_iscntrlCurl_auth_cleanup_ntlmCurl_parse_login_detailsCurl_socket__floatdidfCurl_HMAC_MD5Curl_connect_getsockCurl_sha256itCurl_input_ntlm_wbCurl_compareheaderCurl_parsenetrcCurl_isalnumCurl_output_ntlmCurl_dyn_ptrCurl_connecthostCurl_http_methodcurlx_uztosoCurl_checkheadersCurl_sslCurl_pretransferCurl_ssl_delsessionidCurl_conncache_sizeCurl_pp_moredataCurl_read32_leCurl_HMAC_finalCurl_wildcard_dtor__ltdf2Curl_hostcache_pruneCurl_strntoupperCurl_multi_handleCurl_llist_removeCurl_readrewindCurl_httpCurl_send_plainCurl_http_bodysendCurl_SOCKS4__gedf2Curl_resolv_checkCurl_http_firstwriteCurl_getconnectinfoCurl_auth_build_spnCurl_get_lineCurl_HMAC_updateCurl_share_unlockCurl_handler_dict__aeabi_d2uizCurl_creallocCurl_setup_transferCurl_ftp_parselist_data_freeCurl_cookie_clearsessCurl_dyn_lenCurl_mime_add_headerCurl_pgrsUpdateCurl_initinfoCurl_closesocketCurl_resolver_killcurlx_sitouz__aeabi_i2dCurl_ssl_false_startCurl_conncache_initCurl_ssl_initCurl_pp_sendfCurl_MD5_updateCurl_httpchunk_initCurl_pp_statemachCurl_build_unencoding_stackCurl_pgrsLimitWaitTimeCurl_hash_strCurl_attach_connnection__aeabi_d2ulz__aeabi_ldiv0Curl_output_aws_sigv4Curl_ssl_set_engine_defaultCurl_llist_initCurl_pgrsSetUploadSizeCurl_ipvalid__aeabi_drsubCurl_handler_telnetCurl_pp_state_timeoutCurl_once_resolvedCurl_posttransferCurl_resolver_cleanupCurl_resolver_global_initCurl_tls_keylog_enabledCurl_dyn_vaddfCurl_followCurl_buffer_sendCurl_bufref_initCurl_ssl_backendCurl_expireCurl_none_false_startCurl_init_userdefinedCurl_ssl_tls13_ciphersuitesCurl_cookie_freelistCurl_is_in_callbackCurl_ssl_initsessionsCurl_is_ASCII_name__aeabi_ul2dCurl_pgrsStartNowCurl_ftp_parselist_geterrorCurl_multi_max_host_connectionsCurl_ssl_sessionid_lockCurl_conncache_extract_oldestCurl_input_ntlmCurl_builtin_schemeCurl_none_close_allCurl_disconnectCurl_dyn_uptrCurl_http_targetCurl_cookie_addCurl_bufref_memdupCurl_pgrsTimeCurl_none_init__udivsi3__dso_handleCurl_fileinfo_allocCurl_multiplex_wantedCurl_hsts_initCurl_pgrsSetDownloadCounterCurl_verboseconnectCurl_hostcache_cleanCurl_auth_create_xoauth_bearer_messageCurl_isalphaCurl_printable_addresscurlx_sltosiCurl_addrinfo_callbackCurl_conninfo_localCurl_base64_encodeCurl_getaddrinfoCurl_bufref_lenCurl_pp_readrespCurl_none_session_freeCurl_ipv6_scopeCurl_altsvc_cleanup__aeabi_d2lzCurl_ntlm_core_mk_ntlmv2_respCurl_none_set_engine_defaultCurl_cert_hostcheckcurlx_nonblockCurl_pgrsSetUploadCounter__aeabi_dmulCurl_ssl_connectCurl_hash_deleteCurl_ssl_getsock__muldf3Curl_strntolowerCurl_MD5_initcurlx_uztouiCurl_rtsp_parseheader__divsi3Curl_cache_addrCurl_proxy_connectCurl_auth_create_oauth_bearer_messageCurl_isupperCurl_resolver_is_resolvedCurl_timeleft__subdf3Curl_splaygetbestCurl_copy_header_valueCurl_handler_ftpCurl_sasl_parse_url_auth_optionCurl_hash_start_iterateCurl_resolver_errorCurl_handler_fileCurl_hmacitCurl_isspaceCurl_auth_user_contains_domaincurlx_ultoucCurl_conncontrolCurl_http_input_authCurl_tls_keylog_close__fixunsdfsiCurl_cookie_getlistCurl_islowerCurl_mime_contenttype_endCurl_get_upload_bufferCurl_conncache_add_connCurl_resolver_initCurl_connect_ongoingCurl_free_primary_ssl_configCurl_recv_plainCurl_http_auth_cleanup_digestCurl_alpnid2strCurl_monthCurl_rangeCurl_MD5_finalCurl_fnmatchCurl_none_data_pendingCurl_unencode_cleanupCurl_ssl_data_pendingCurl_conncache_find_bundleCurl_pgrsSetDownloadSizeCurl_init_dnscachecurlx_ultousCurl_timediffCurl_str_key_compareCurl_done_sendingCurl_mime_cleanpartCurl_ntlm_core_mk_ntlmv2_hashCurl_ntlm_core_mk_lmv2_respCurl_hash_pickCurl_checkProxyheaders__divdf3Curl_llist_destroy__aeabi_dcmpgt__end__Curl_base64_decodeCurl_dyn_initCurl_pop3_write__aeabi_idiv0Curl_updateconninfoCurl_conninfo_remoteCurl_input_digestCurl_rand_hexCurl_handler_smbCurl_altsvc_ctrlCurl_setbloboptCurl_http_resumeCurl_HMAC_init__bss_startCurl_conncache_foreachCurl_ssl_config_matches__ledf2Curl_http_compile_trailers__floatsidfCurl_meets_timeconditionCurl_conn_data_pendingCurl_set_dns_interfaceCurl_wait_msCurl_getdate_cappedCurl_use_http_1_1plus__aeabi_cdcmpeqCurl_ssl_free_certinfoCurl_cookie_initCurl_cstrdupCurl_flush_cookiesCurl_hstsCurl_hsts_saveCurl_handler_rtspCurl_handler_gopherCurl_connect_doneCurl_mime_rewind__aeabi_cdrcmpleCurl_ssl_push_certinfoCurl_doh_is_resolvedCurl_md4itCurl_getinfoCurl_GetFTPResponse__nedf2Curl_conncache_close_all_connections_DYNAMICCurl_setup_connCurl_bufref_setCurl_ssl_kill_sessionCurl_sasl_cleanupCurl_setstroptCurl_altsvc_initCurl_llist_insert_nextcurlx_sltouscurlx_strtoofftCurl_smtp_escape_eobCurl_pollcurlx_uztoszCurl_gmtimeCurl_auth_create_plain_messageCurl_dyn_addfCurl_resolver_getaddrinfoCurl_he2aiCurl_ossl_verifyhostCurl_single_getsock__floatundidf__udivmoddi4curlx_sltouicurlx_uitousCurl_cookie_clearallCurl_http_output_authCurl_http_headerCurl_ssl_check_cxnCurl_http_sizeCurl_freeaddrinfoCurl_connaliveCurl_add_custom_headersCurl_handler_smbsCurl_hash_next_elementCurl_http_auth_act__aeabi_uidivmodCurl_none_randomCurl_multiuse_stateCurl_none_cert_status_requestCurl_resolver_global_cleanupcurl_jmpenvCurl_isunreservedCurl_fillreadbufferCurl_pgrsResetTransferSizesCurl_wkdayCurl_auth_digest_cleanupCurl_ntlm_core_mk_lm_hashCurl_sasl_continueCurl_handler_imapCurl_http_auth_cleanup_ntlmCurl_mime_readCurl_connect_completeCurl_cookie_loadfilesCurl_ssl_randomCurl_gethostnameCurl_ratelimitCurl_mime_set_subpartsCurl_safe_strcasecompareCurl_wildcard_initCurl_write_plainCurl_handler_pop3Curl_ssl_cert_status_requestCurl_update_timerCurl_dyn_addnCurl_http_connectCurl_cookie_listCurl_http_doneCurl_slist_append_nodupCurl_ssl_init_certinfo__fixunsdfdi__fixdfdiCurl_HMAC_SHA256Curl_auth_create_external_messageCurl_SOCKS5Curl_renameCurl_dyn_addCurl_freesetCurl_init_CONNECTCurl_add_timeconditionCurl_recv_has_postponed_dataCurl_hsts_cleanupCurl_sasl_startCurl_ssl_detach_connCurl_handler_httpsCurl_hsts_loadcbCurl_init_doCurl_pp_setup__TMC_END___GLOBAL_OFFSET_TABLE_Curl_resolv_timeoutCurl_connect_freeCurl_auth_create_login_messageCurl_ssl_connect_nonblocking__aeabi_idivCurl_detach_connnection__gtdf2Curl_client_writeCurl_resolv_unlockCurl_transferencodeCurl_debugCurl_randCurl_conncache_destroyCurl_pp_disconnectCurl_multi_add_performCurl_hash_destroyCurl_readwriteCurl_sasl_initCurl_md5itCurl_ssl_push_certinfo_lenCurl_unencode_writeCurl_ssl_openssl__aeabi_dcmpeqCurl_cookie_cleanupCurl_resolvCurl_strncasecompareCurl_persistconninfoCurl_dyn_vprintfCurl_is_connectedCurl_speedcheck__aeabi_dadd__aeabi_dcmpgeCurl_ftp_parselist__floatunsidfCurl_num_addressesCurl_ssl_sessionid_unlockCurl_ssl_engines_listCurl_sasl_decode_mechcurlx_sotouzCurl_speedinitCurl_multi_max_concurrent_streams__aeabi_ui2dCurl_ccallocCurl_preconnectCurl_expire_clearCurl_pgrsDoneCurl_isxdigitCurl_none_engines_list__aeabi_dcmplt__extendsfdf2Curl_vsetoptCurl_updatesocketCurl_resolver_duphandleCurl_http_cookiesCurl_DIGEST_MD5Curl_ssl_set_engineCurl_none_cleanupCurl_httpchunk_readCurl_all_content_encodingsCurl_read_plain__aeabi_l2dCurl_auth_is_ntlm_supportedCurl_str2addrCurl_ntlm_core_mk_nt_hashCurl_memrchr__aeabi_ddivCurl_clone_primary_ssl_configCurl_pp_flushsendEVP_PKEY_copy_parameterscalloc@@GLIBC_2.4X509_LOOKUP_fileASN1_TIME_printstrstr@@GLIBC_2.4ASN1_STRING_lengthgetpwuid_r@@GLIBC_2.4SSL_get_errorraise@@GLIBC_2.4curl_easy_escapeRAND_statusares_cancelcurl_freeares_timeoutPKCS12_freei2a_ASN1_OBJECTgmtime_r@@GLIBC_2.4curl_global_sslsetCONF_modules_load_fileENGINE_freeCRYPTO_freecurl_mvsprintfsk_pop_freestrcmp@@GLIBC_2.4__cxa_finalize@@GLIBC_2.4strtol@@GLIBC_2.4curl_multi_fdsetsk_pop_ITM_deregisterTMCloneTablesetsockopt@@GLIBC_2.4strcspn@@GLIBC_2.4curl_global_cleanupd2i_PrivateKey_bioRAND_load_filecurl_easy_getinfoSSL_writeERR_peek_last_errorENGINE_set_defaultgetifaddrs@@GLIBC_2.4inflatefflush@@GLIBC_2.4SSLv23_client_methodERR_peek_errorERR_remove_thread_stateSSL_get_ex_datask_valueMD5_Finalmemmove@@GLIBC_2.4curl_maprintfOCSP_CERTID_freecurl_easy_performSSL_get_shutdownASN1_STRING_typefree@@GLIBC_2.4CRYPTO_mallocSSL_freeOCSP_BASICRESP_freecurl_version_infofgets@@GLIBC_2.4EVP_DigestFinal_excurl_easy_unescapeX509_STORE_add_lookupENGINE_initares_library_initUI_method_set_readerRAND_egdOCSP_response_statusinet_pton@@GLIBC_2.4clock_gettime@@GLIBC_2.17SSL_CTX_use_certificate_chain_fileENGINE_cleanupmemcpy@@GLIBC_2.4curl_slist_appendSSL_set_fdSSL_get_ex_new_indexX509_NAME_ENTRY_get_datacurl_formfreeSSL_CTX_set_verifyftell@@GLIBC_2.4memcmp@@GLIBC_2.4d2i_X509_biostpcpy@@GLIBC_2.4freeifaddrs@@GLIBC_2.4BN_num_bitsUI_create_methodENGINE_ctrl_cmdcurl_multi_pollrecvfrom@@GLIBC_2.4curl_multi_info_readSSL_CTX_set_default_passwd_cbstrdup@@GLIBC_2.4EVP_sha1OPENSSL_load_builtin_modulesSSL_CTX_set_default_passwd_cb_userdataSSL_CTX_set_next_proto_select_cbcurl_urlRAND_bytesRSA_freeUI_method_get_readerunlink@@GLIBC_2.4ASN1_STRING_datadup2@@GLIBC_2.4X509_get_subject_nameBIO_printfrealloc@@GLIBC_2.4EVP_PKEY_freesocketpair@@GLIBC_2.4SSL_get_peer_cert_chainares_gethostbynameX509_get_issuer_namecurl_multi_remove_handlecurl_url_strerrorEVP_DigestInitcurl_formget__rawmemchr@@GLIBC_2.4SSL_get_versioncurl_mime_typegeteuid@@GLIBC_2.4ares_set_servers_ports_csvpoll@@GLIBC_2.4accept@@GLIBC_2.4__fxstat64@@GLIBC_2.4SSL_set_ex_datasigaction@@GLIBC_2.4stderr@@GLIBC_2.4OCSP_cert_to_idfwrite@@GLIBC_2.4MD4_Updategetsockopt@@GLIBC_2.4SSL_CTX_sess_set_new_cbOCSP_resp_find_statuslseek64@@GLIBC_2.4strtoll@@GLIBC_2.4ares_init_optionsPKCS12_parseUI_destroy_methodwaitpid@@GLIBC_2.4d2i_PKCS12_biostrcpy@@GLIBC_2.4MD4_InitSSL_library_initgettimeofday@@GLIBC_2.4d2i_OCSP_RESPONSEcurl_formaddfread@@GLIBC_2.4curl_easy_upkeepcurl_escapeDES_ecb_encryptSSL_CTX_set_srp_usernameBIO_f_sslPKCS12_PBE_addUI_method_set_closerSSL_readstrtok_r@@GLIBC_2.4ares_set_local_ip4X509_verify_cert_error_stringgethostname@@GLIBC_2.4SSL_SESSION_freeEVP_DigestInit_excurl_url_setERR_error_string_ncurl_mime_dataares_set_local_ip6SSL_get_current_ciphercurl_easy_option_by_nameX509_get_serialNumberSSL_CTX_ctrlfnmatch@@GLIBC_2.4SSL_newcurl_strnequalcurl_multi_initX509V3_EXT_printgetenv@@GLIBC_2.4RAND_addcurl_multi_add_handleOPENSSL_add_all_algorithms_noconfmalloc@@GLIBC_2.4SSL_set_connect_stateSSL_CTX_use_certificate_filestrftime@@GLIBC_2.4SSL_shutdownMD4_Finalcurl_multi_performSSL_CTX_set_srp_passwordSSL_COMP_free_compression_methodsOCSP_crl_reason_strX509_EXTENSION_get_objectX509_INFO_freeOCSP_basic_verifycurl_share_setoptcurl_share_cleanupcurl_pushheader_byname__ctype_tolower_loc@@GLIBC_2.4curl_strequal__gmon_start__EVP_cleanupares_getsockrename@@GLIBC_2.4RSA_flagskill@@GLIBC_2.4ERR_clear_errorgetpid@@GLIBC_2.4exit@@GLIBC_2.4curl_easy_resetGENERAL_NAMES_freeX509_EXTENSION_get_dataX509_get_pubkeyfeof@@GLIBC_2.4SSLeayPEM_write_bio_X509curl_global_init_memERR_free_stringsENGINE_ctrlinflateEndstrtoul@@GLIBC_2.4strlen@@GLIBC_2.4BIO_new_mem_bufUI_method_get_closerEVP_DigestUpdatecurl_easy_duphandlecurl_url_getstrchr@@GLIBC_2.4curl_mime_data_cbOCSP_response_status_strcurl_mime_namecurl_multi_setoptOCSP_RESPONSE_freeSSL_get0_alpn_selectedSSL_CTX_add_client_CAcurl_mime_encoderASN1_STRING_printSSL_CTX_newPEM_read_bio_X509_AUXASN1_INTEGER_getBN_printcurl_multi_waitstdin@@GLIBC_2.4fcntl@@GLIBC_2.4EVP_PKEY_get1_RSAares_process_fdEVP_MD_CTX_destroy__errno_location@@GLIBC_2.4CONF_modules_freei2t_ASN1_OBJECTX509_STORE_add_certUI_OpenSSLENGINE_get_nextares_version__isoc99_sscanf@@GLIBC_2.7curl_global_initSSL_get_peer_certificateX509_NAME_get_entrySSL_get_certificatebind@@GLIBC_2.4setvbuf@@GLIBC_2.4BIO_newBIO_ctrlmemset@@GLIBC_2.4BIO_freecurl_easy_sendSSL_CTX_load_verify_locationsOCSP_cert_status_strstrncpy@@GLIBC_2.4X509_get_ext_d2iX509_load_crl_filecurl_easy_init__xpg_basename@@GLIBC_2.4curl_multi_socketcurl_pushheader_bynumcurl_mime_headersUI_method_set_writerUI_get0_user_dataSSL_ctrlfileno@@GLIBC_2.4curl_easy_strerrorcurl_msnprintfcurl_getenvcurl_mime_initX509_STORE_set_flagsSSL_pendingcurl_multi_wakeupaccess@@GLIBC_2.4curl_mime_filedataSSL_CTX_use_PrivateKey_filecurl_msprintfstdout@@GLIBC_2.4fclose@@GLIBC_2.4SSL_CTX_set_cipher_listcurl_easy_pauseinflateInit_DES_set_odd_parityi2d_X509_PUBKEYcurl_mime_freeENGINE_get_firstares_destroycurl_mprintfcurl_share_strerrorsendto@@GLIBC_2.4curl_share_initX509_freeENGINE_finishOCSP_check_validityX509_NAME_get_index_by_NIDcurl_multi_assignfork@@GLIBC_2.4X509_NAME_print_ex__xpg_strerror_r@@GLIBC_2.4curl_mfprintfcurl_mvfprintfexecl@@GLIBC_2.4curl_versionsk_numstrrchr@@GLIBC_2.4curl_unescapelisten@@GLIBC_2.4curl_slist_free_allSSL_get_sessionX509_STORE_add_crlUI_method_set_openerSSL_connectSSL_CTX_freefputc@@GLIBC_2.4inflateInit2_SSL_load_error_strings_Jv_RegisterClassescurl_multi_cleanupDES_set_key_uncheckedcurl_mime_filenameSSL_set_sessioncurl_multi_timeoutcurl_url_cleanupsprintf@@GLIBC_2.4UI_set_resultERR_get_errorcurl_mvprintfgetsockname@@GLIBC_2.4UI_get_input_flagsUI_method_get_writerPEM_X509_INFO_read_bioX509_check_issuedfopen64@@GLIBC_2.4qsort@@GLIBC_2.4getpeername@@GLIBC_2.4SSL_CTX_use_PrivateKeySSL_get_privatekeySSL_alert_desc_string_longSSL_CTX_get_cert_storeBIO_putsUI_get_string_typezlibVersionstrpbrk@@GLIBC_2.4MD5_Initcurl_multi_socket_allcurl_mvsnprintfcurl_multi_socket_actioncurl_mvaprintfcurl_easy_setoptcurl_getdatePEM_read_bio_PrivateKeyinet_ntop@@GLIBC_2.4ENGINE_load_builtin_enginesSSL_CTX_check_private_keysocket@@GLIBC_2.4curl_mime_subpartsPEM_read_bio_X509_ITM_registerTMCloneTablecurl_multi_strerrorares_library_cleanupSSL_CTX_set_msg_callbackUI_method_get_openerSSL_CIPHER_get_nameif_nametoindex@@GLIBC_2.4curl_easy_cleanupSSL_CTX_use_certificatecurl_easy_recvBIO_s_filecurl_easy_option_nextEVP_sha256fseek@@GLIBC_2.4SSL_CTX_set_alpn_protos__xstat64@@GLIBC_2.4SSL_get_verify_resultMD5_UpdateASN1_STRING_to_UTF8fputs@@GLIBC_2.4strncmp@@GLIBC_2.4curl_url_dupENGINE_load_private_keyrecv@@GLIBC_2.4ENGINE_get_idBIO_s_memRAND_file_namesend@@GLIBC_2.4connect@@GLIBC_2.4curl_mime_addpartares_set_local_devEVP_MD_CTX_createstrspn@@GLIBC_2.4ENGINE_by_idSSL_set_bioOCSP_response_get1_basiccurl_easy_option_by_id.symtab.strtab.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes.debug_aranges.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges !  )4%4%1o==6>oAA@M \A\A0V BZZ _|e|e Zee|evv}kqԭyp̡̡ ԡԡТТԢԢآآܢܢ 000((0(+pS0`r&qC#hX,07%\B8(H("6  `iGOP